KEGG   Pseudomonas mendocina NK-01: MDS_2263Help
Entry
MDS_2263          CDS       T01473                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MDS_2263
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MDS_2263
   00640 Propanoate metabolism
    MDS_2263
   00660 C5-Branched dibasic acid metabolism
    MDS_2263
Enzymes [BR:pmk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MDS_2263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2470239..2471405
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGFAVDTPEEAAEACEKIGGSEWVVKAQVHAGGRGKAGGV
KLVKSKEDAKAFAANWLGKRLVTYQTDANGQPVSKILVESCTDIAKELYLGAVVDRSSRR
IVFMASTEGGVDIEKVAHETPEKILKATVDPLVGAQPYQGRELAFQLGLEGDQVKQFTHI
FVGLAKLFQDYDLALLEVNPLVIKADGNLHCLDAKINIDSNAMYRQPKLRAMHDPSQDDP
REAHAQKWELNYVALEGNIGCMVNGAGLAMGTMDIVNLHGGQPANFLDVGGGATKERVTE
AFKIILSDDNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKIPVVVRLEGNNAELGAKV
LADSGLNIIAATSLTDAAQQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgagtatcagggtaagcagctgttcgctgaatacggcctgcctgtatcc
aagggcttcgcggtggacaccccggaagaagccgcagaagcctgcgaaaaaatcggcggc
agcgagtgggtcgtcaaggctcaggtccacgctggtggccgcggcaaagccggtggcgta
aagctggtcaagagcaaggaagacgccaaggccttcgccgccaactggctgggcaagcgt
ctggtgacctaccagactgacgccaatggtcagccggtcagcaaaatcctggtcgaatcc
tgcaccgacatcgccaaggaactgtacctgggcgccgtcgtggaccgttccagccgtcgc
atcgtgttcatggcttccaccgaaggtggcgtggacatcgagaaagtggctcacgaaacc
cctgagaagatcctcaaggccaccgtcgatccgctggtcggcgctcagccgtaccagggc
cgcgagctggctttccagctgggtctggaaggcgatcaggtcaagcagttcacccacatc
ttcgttggcctggccaagctgttccaggactacgacctggctctgctggaagtgaacccg
ctggtgatcaaggctgacggcaacctgcactgcctggacgccaagatcaacatcgactcc
aacgccatgtaccgtcagcccaagctgcgcgccatgcacgatccgtcccaggacgatccg
cgtgaagcccatgcgcagaagtgggagctgaactacgttgcgctggaaggcaacatcggt
tgcatggtcaacggtgctggcctggccatgggcaccatggacatcgtcaacctgcacggc
ggtcagccggccaacttcctcgacgtaggtggtggcgcgaccaaagagcgcgtgaccgaa
gcgttcaagatcatcctctccgatgacaacgtcaaagccgttctggtgaacatcttcggc
ggtatcgttcgttgcgacatgattgccgaaggcatcatcggcgcggtgaaggaagttggc
gtgaagatcccggtggtcgtccgtctcgaaggtaacaacgccgagctgggcgccaaggtc
ctggctgacagcggtctgaacatcatcgcggcaaccagcctgaccgacgctgcccagcag
gtcgtcaaggccgcggagggtaagtaa

DBGET integrated database retrieval system