KEGG   Pseudomonas mendocina NK-01: MDS_2263Help
Entry
MDS_2263          CDS       T01473                                 

Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk00020  Citrate cycle (TCA cycle)
pmk00640  Propanoate metabolism
pmk00660  C5-Branched dibasic acid metabolism
pmk01100  Metabolic pathways
pmk01110  Biosynthesis of secondary metabolites
pmk01120  Microbial metabolism in diverse environments
pmk01130  Biosynthesis of antibiotics
pmk01200  Carbon metabolism
Module
pmk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pmk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MDS_2263
   00640 Propanoate metabolism
    MDS_2263
   00660 C5-Branched dibasic acid metabolism
    MDS_2263
Enzymes [BR:pmk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MDS_2263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AEB58294
UniProt: F4DS95
Position
2470239..2471405
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGFAVDTPEEAAEACEKIGGSEWVVKAQVHAGGRGKAGGV
KLVKSKEDAKAFAANWLGKRLVTYQTDANGQPVSKILVESCTDIAKELYLGAVVDRSSRR
IVFMASTEGGVDIEKVAHETPEKILKATVDPLVGAQPYQGRELAFQLGLEGDQVKQFTHI
FVGLAKLFQDYDLALLEVNPLVIKADGNLHCLDAKINIDSNAMYRQPKLRAMHDPSQDDP
REAHAQKWELNYVALEGNIGCMVNGAGLAMGTMDIVNLHGGQPANFLDVGGGATKERVTE
AFKIILSDDNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKIPVVVRLEGNNAELGAKV
LADSGLNIIAATSLTDAAQQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgagtatcagggtaagcagctgttcgctgaatacggcctgcctgtatcc
aagggcttcgcggtggacaccccggaagaagccgcagaagcctgcgaaaaaatcggcggc
agcgagtgggtcgtcaaggctcaggtccacgctggtggccgcggcaaagccggtggcgta
aagctggtcaagagcaaggaagacgccaaggccttcgccgccaactggctgggcaagcgt
ctggtgacctaccagactgacgccaatggtcagccggtcagcaaaatcctggtcgaatcc
tgcaccgacatcgccaaggaactgtacctgggcgccgtcgtggaccgttccagccgtcgc
atcgtgttcatggcttccaccgaaggtggcgtggacatcgagaaagtggctcacgaaacc
cctgagaagatcctcaaggccaccgtcgatccgctggtcggcgctcagccgtaccagggc
cgcgagctggctttccagctgggtctggaaggcgatcaggtcaagcagttcacccacatc
ttcgttggcctggccaagctgttccaggactacgacctggctctgctggaagtgaacccg
ctggtgatcaaggctgacggcaacctgcactgcctggacgccaagatcaacatcgactcc
aacgccatgtaccgtcagcccaagctgcgcgccatgcacgatccgtcccaggacgatccg
cgtgaagcccatgcgcagaagtgggagctgaactacgttgcgctggaaggcaacatcggt
tgcatggtcaacggtgctggcctggccatgggcaccatggacatcgtcaacctgcacggc
ggtcagccggccaacttcctcgacgtaggtggtggcgcgaccaaagagcgcgtgaccgaa
gcgttcaagatcatcctctccgatgacaacgtcaaagccgttctggtgaacatcttcggc
ggtatcgttcgttgcgacatgattgccgaaggcatcatcggcgcggtgaaggaagttggc
gtgaagatcccggtggtcgtccgtctcgaaggtaacaacgccgagctgggcgccaaggtc
ctggctgacagcggtctgaacatcatcgcggcaaccagcctgaccgacgctgcccagcag
gtcgtcaaggccgcggagggtaagtaa

DBGET integrated database retrieval system