KEGG   Pseudomonas mendocina NK-01: MDS_2362Help
Entry
MDS_2362          CDS       T01473                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MDS_2362
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MDS_2362
Enzymes [BR:pmk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     MDS_2362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2585244..2586839)
Genome map
AA seq 531 aa AA seqDB search
MSAYQNDIKAVAALKEKFGSSWSAINPESVARMRAQNRFKTGLEIAQYTADIMRKDMEEY
DADSSVYTQSLGCWHGFIGQQKLISIKKHLKTTNKRYLYLSGWMVAALRSDFGPLPDQSM
HEKTAVSDLIEELYTFLRQADSRELDLLFTALDAARDAGDHAKAAEIQNQIDNYETHIVP
IIADIDAGFGNPEATYLLAKRMIEAGACCIQIENQVSDEKQCGHQDGKVTVPHADFLAKI
AAVRYAFLELGIDNGVIVARTDSLGAGLTKQIAVTKEPGDLGDLYNSFLDCEEVSAADLG
NGDVVINRGGKLLRPKRLPSNLFQFRKGTGEDRCVLDCITSLQNGADLLWIETEKPHVGQ
IKAMVDRIREVIPNAKLVYNNSPSFNWTLNFRQQVFDAMVAEGKDVSAYDRAKLMSVEYD
ETELAQIADEKIRTFQRDGSAHAGIFHHLITLPTYHTAALSTDNLAKGYFADQGMLAYVK
GVQRQELRQGIACVKHQNMAGSDIGDNHKEYFAGEAALKASGKDNTMNQFH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcatatcaaaacgacatcaaggctgtagccgctctgaaagagaagttcggcagc
agctggagcgctatcaaccccgagtccgtcgcccgtatgcgcgctcagaaccgcttcaag
accggtctggaaatcgctcagtacaccgctgacatcatgcgcaaggatatggaagagtac
gacgccgactcctccgtctacacccagtccctgggctgctggcacggcttcatcggtcag
cagaagctgatctcgatcaagaagcacctgaagaccaccaacaagcgctacctctacctg
tccggctggatggttgctgccctgcgctccgacttcggcccgctgccggaccagtcgatg
cacgagaagactgccgtctccgacctgatcgaagagctgtacaccttcctgcgtcaggcc
gacagccgcgaactggacctgctgttcaccgcgctggacgccgctcgtgatgctggcgac
cacgccaaggctgccgagatccagaaccagatcgacaactacgaaacgcacattgtcccg
atcatcgccgacatcgatgccggtttcggtaacccggaagccacctacctgctggccaag
cgcatgatcgaagccggtgcctgctgcatccagatcgagaaccaggtttccgacgagaag
cagtgcggccaccaggacggtaaagtgaccgttcctcacgccgacttcctcgccaagatc
gctgccgttcgctacgccttcctcgaactgggcatcgacaacggcgtgatcgtcgctcgt
accgattccctgggtgccggcctgaccaagcagatcgccgtgaccaaagagccgggtgac
ctgggcgacctgtacaacagcttcctcgattgcgaagaagtgtccgctgccgacctgggc
aatggcgatgtcgtgatcaaccgcggcggcaaactgctgcgtccgaagcgcctgccgtcc
aacctgttccagttccggaagggcactggcgaagaccgctgcgtactggactgcatcacc
agcctgcagaacggcgccgacctgctgtggatcgaaaccgagaagccgcacgttggccag
atcaaggccatggttgaccgcatccgcgaagtcatcccgaacgccaaactggtgtacaac
aacagcccgtccttcaactggacgctgaacttccgtcagcaggtgttcgacgccatggtt
gccgaaggcaaggatgtttccgcctacgaccgcgccaagctgatgagcgtcgagtacgac
gagaccgagctggctcagatcgccgacgagaagatccgtaccttccagcgcgatggttct
gcccacgccggcatcttccaccacctgatcaccctgccgacctaccacactgcggctctg
tccaccgacaacctggccaagggctacttcgccgaccagggcatgctggcctacgtgaaa
ggtgttcagcgtcaggaactgcgtcagggtatcgcctgcgtcaagcaccagaacatggct
ggctccgacatcggcgacaaccacaaggagtacttcgctggcgaagctgctctgaaggcg
agcggtaaagacaacaccatgaaccagttccactaa

DBGET integrated database retrieval system