KEGG   Pseudomonas mendocina NK-01: MDS_2418Help
Entry
MDS_2418          CDS       T01473                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk00040  Pentose and glucuronate interconversions
pmk00052  Galactose metabolism
pmk00500  Starch and sucrose metabolism
pmk00520  Amino sugar and nucleotide sugar metabolism
pmk01100  Metabolic pathways
pmk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MDS_2418
   00052 Galactose metabolism
    MDS_2418
   00500 Starch and sucrose metabolism
    MDS_2418
   00520 Amino sugar and nucleotide sugar metabolism
    MDS_2418
Enzymes [BR:pmk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MDS_2418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEB58449
UniProt: F4DU21
Position
2642743..2643582
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALEAGLDQISIVTGRGKR
ALEDHFDVSYELEHQIKGTDKEKYLVGIRRLIDECSFSYTRQVEMKGLGHAILCGQPLIG
DEPFAVVLADDLCLNLEGDSVLAQMVKLYNQFRCSIVAIQEVPRDETSKYGVIAGEMIRE
DIYRVSNMVEKPKPEDAPSNLAIIGRYILTPDIFDLIRSTPPGKGGEIQITDALMRQAQQ
GCVMAYKFKGQRFDCGSAEGYIDATNFCFENLYKTGKAF
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaatgcctgttccccgctgccggttacggcacccgctttttgccagcgacc
aaggcaatgcccaaggaaatgcttccggtggtgaacaagccactgatccagtacggcgtc
gaagaggcactggaagctggcctcgaccagatttccatcgtcaccggccgtggcaagcgc
gcactggaagaccatttcgacgtgagctatgagctcgagcatcagatcaagggcaccgac
aaggaaaaatacctggttggcatccgtcgcctgatcgacgagtgcagcttctcctacacc
cgtcaggtcgagatgaaaggcctgggccacgccatcctttgcggtcagccgctgataggt
gacgagcccttcgccgtggttctggccgacgacctgtgcctgaacctcgaaggcgacagc
gtactggcgcagatggtcaagctgtacaaccagttccgctgctccatcgtcgcgatccag
gaagtgccgagggacgaaacctccaagtacggtgtgatcgccggcgagatgatccgcgag
gacatctaccgcgtcagcaacatggtggagaagcccaagcccgaggacgcgccgtcgaac
ctggcgatcatcggtcgctacatcctcaccccggacatcttcgacctgatccgcagcacg
ccgccgggcaagggcggtgagatccagatcaccgacgccctgatgcgccaggcccagcag
ggctgcgtaatggcatacaagttcaagggccagcgtttcgactgcggtagcgccgagggt
tacatcgacgcgaccaacttctgcttcgagaatctgtacaagaccggcaaggcgttctga

DBGET integrated database retrieval system