KEGG   Pseudomonas mendocina NK-01: MDS_2418Help
Entry
MDS_2418          CDS       T01473                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MDS_2418
   00052 Galactose metabolism
    MDS_2418
   00500 Starch and sucrose metabolism
    MDS_2418
   00520 Amino sugar and nucleotide sugar metabolism
    MDS_2418
Enzymes [BR:pmk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MDS_2418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2642743..2643582
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALEAGLDQISIVTGRGKR
ALEDHFDVSYELEHQIKGTDKEKYLVGIRRLIDECSFSYTRQVEMKGLGHAILCGQPLIG
DEPFAVVLADDLCLNLEGDSVLAQMVKLYNQFRCSIVAIQEVPRDETSKYGVIAGEMIRE
DIYRVSNMVEKPKPEDAPSNLAIIGRYILTPDIFDLIRSTPPGKGGEIQITDALMRQAQQ
GCVMAYKFKGQRFDCGSAEGYIDATNFCFENLYKTGKAF
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaatgcctgttccccgctgccggttacggcacccgctttttgccagcgacc
aaggcaatgcccaaggaaatgcttccggtggtgaacaagccactgatccagtacggcgtc
gaagaggcactggaagctggcctcgaccagatttccatcgtcaccggccgtggcaagcgc
gcactggaagaccatttcgacgtgagctatgagctcgagcatcagatcaagggcaccgac
aaggaaaaatacctggttggcatccgtcgcctgatcgacgagtgcagcttctcctacacc
cgtcaggtcgagatgaaaggcctgggccacgccatcctttgcggtcagccgctgataggt
gacgagcccttcgccgtggttctggccgacgacctgtgcctgaacctcgaaggcgacagc
gtactggcgcagatggtcaagctgtacaaccagttccgctgctccatcgtcgcgatccag
gaagtgccgagggacgaaacctccaagtacggtgtgatcgccggcgagatgatccgcgag
gacatctaccgcgtcagcaacatggtggagaagcccaagcccgaggacgcgccgtcgaac
ctggcgatcatcggtcgctacatcctcaccccggacatcttcgacctgatccgcagcacg
ccgccgggcaagggcggtgagatccagatcaccgacgccctgatgcgccaggcccagcag
ggctgcgtaatggcatacaagttcaagggccagcgtttcgactgcggtagcgccgagggt
tacatcgacgcgaccaacttctgcttcgagaatctgtacaagaccggcaaggcgttctga

DBGET integrated database retrieval system