KEGG   Pseudomonas mendocina NK-01: MDS_2439Help
Entry
MDS_2439          CDS       T01473                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pmk00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2663113..2665260
Genome map
AA seq 715 aa AA seqDB search
MQRLQRAEDGDPFSFLGPHPQGDESLVRVWLPGADAVDLLASDGSPLGRMHCSDPQGLFE
LQLPQAQRYRLRIHWPGSVQETEDPYAFGPLLGDTDLYLFAEGNHRQLWRCLGSAPMEHE
GVPGVRFAVWAPNARRVSVVGDFNSWDGRRHPMRLRYPAGVWELFIPRLQPGECYKYEIL
GEHGVLPLRADPMAQATEVPPATASKVPQDEAFAWQDQQWMSERQQRHAPQAPLAIYELH
AGSWQWHNDHAPDWDELAERLIPYVQDLGFTHIELMPIMEHPFGGSWGYQPLSMFAPTSR
FGSPQRFAAFVDRCHRAGIGVILDWVPGHFPNDAHGLAEFDGTALYEYAHPFEGFHPDWN
TCIYNLGRTEVHGFMLASALYWLREYHVDGLRVDAVASMLYRDYSREAGQWIPNRHGGRE
NLEAIEFLQHLNEVVRNEVPDALMIAEESTAWPGVSRPVQQGGLGFSHKWNMGWMNDSLS
YIQQDPMYRLHHHHQITFGLHYAFSERFILPISHDEVVHGKRSLLGRMPGDRWQQFANLR
LFLALMWSHPGKKLLFMGCEFGQWGEWNHDQQLDWYLLQYPEHAAAQALVRELNRLYREE
PALHRLDDQDSGFQWVIGDDAHNSVFAWLRKGGEGSAPLLVVHNFTPQVLDGYRVGVPHA
GRWQVLLNSDERRWSGSGAGSEGELHTEHLAAHGQSDSLNLQLPPLATLILRPAQ
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcgcctgcagcgcgccgaagatggcgatccgttcagcttccttggtcctcacccg
cagggtgacgagagcctggtgcgagtctggctgcccggtgccgacgcggtggacctgctg
gccagcgacggctcgccgctggggcgcatgcactgcagcgacccgcagggcctgttcgaa
ttgcagctgccccaggcgcagcgctaccgcctgcgcatccactggccgggcagcgtgcag
gaaacggaagatccctatgccttcggcccgctgctgggtgataccgacctctacctgttc
gccgaaggcaaccaccgtcagctgtggcgctgcctgggctcggcaccgatggagcatgaa
ggcgtgcctggggtgcgcttcgccgtctgggcgcccaatgcgcggcgggtgtcggtggtt
ggcgacttcaacagctgggacgggcgccgccaccccatgcgtttgcgctacccggcgggc
gtgtgggagctgttcatcccgaggctgcagcccggcgaatgctacaaatacgaaattctc
ggtgagcacggtgtgctgccgctgcgcgcagaccccatggcgcaagccaccgaggtaccg
ccggccaccgcctcgaaggtgccacaggatgaagcctttgcctggcaggaccagcagtgg
atgagcgaacgccagcaacgccatgctccgcaggcaccgctggcgatctacgagctgcat
gccggctcctggcaatggcataacgatcatgcacccgactgggacgagctggcagaacgg
ctgattccctacgtgcaggacctgggcttcacccatatcgaactgatgccgatcatggag
cacccgttcggcggttcctggggttaccagccgctgtcgatgttcgcgcccacctcacgc
ttcggcagcccgcaacgcttcgctgccttcgtcgatcgctgccaccgcgccggcatcggc
gtgattctcgactgggtgccggggcatttccccaacgatgcccacggcctggccgagttc
gacggcaccgcgctttacgagtacgcgcacccgttcgagggttttcacccggactggaac
acctgcatctacaacctcggccgcactgaggtgcacggtttcatgctggccagcgcgctg
tactggttgcgcgagtaccacgtcgacggcctacgcgtggatgcggtggcgtcgatgctc
tatcgcgattattcgcgtgaagcggggcagtggattcccaaccgccacggcgggcgcgag
aacctggaggctatcgaattcctccagcatctcaacgaggtggtgcgcaacgaagtgccc
gacgcgttgatgatcgccgaggaatccaccgcctggcctggcgtcagtcgcccggtgcag
caaggcggcctgggcttcagccacaaatggaacatgggctggatgaacgacagcctgagc
tatatccagcaggacccgatgtaccgcctgcaccatcaccaccagatcaccttcggcctg
cattacgccttctccgagcgctttatcctgccgatctcccatgacgaggtggtgcacggc
aaacgctcactgctcgggcgcatgccaggtgatcgctggcagcaattcgccaacctgcgc
ctgttcctcgccctgatgtggagccacccgggcaagaagctgctgttcatgggctgcgag
ttcggccagtggggcgagtggaaccacgaccagcaactggactggtacctgctgcagtat
ccggagcatgcggctgcccaggcgctggtacgcgagctgaatcgcctgtaccgcgaggag
ccggcgttgcaccgcctcgatgaccaggacagcggtttccaatgggttatcggcgatgac
gcgcacaacagcgtgttcgcctggttgcgcaagggcggcgagggcagcgcgccgctgctg
gtggtgcacaacttcaccccgcaggtgctcgacggctaccgggtcggcgtaccgcacgct
ggccgctggcaggtgctgctcaacagcgatgaacgtcgctggagcggttcgggcgcaggt
agcgagggtgaactgcacacggagcacctggccgctcacggccagtccgattcgttgaat
ctgcaattgccgccgttggcgacgctgattctgcggccggcgcaatga

DBGET integrated database retrieval system