KEGG   Pseudomonas mendocina NK-01: MDS_2614Help
Entry
MDS_2614          CDS       T01473                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk00071  Fatty acid degradation
pmk00280  Valine, leucine and isoleucine degradation
pmk00281  Geraniol degradation
pmk00310  Lysine degradation
pmk00360  Phenylalanine metabolism
pmk00362  Benzoate degradation
pmk00380  Tryptophan metabolism
pmk00410  beta-Alanine metabolism
pmk00627  Aminobenzoate degradation
pmk00640  Propanoate metabolism
pmk00650  Butanoate metabolism
pmk00903  Limonene and pinene degradation
pmk00930  Caprolactam degradation
pmk01100  Metabolic pathways
pmk01110  Biosynthesis of secondary metabolites
pmk01120  Microbial metabolism in diverse environments
pmk01130  Biosynthesis of antibiotics
pmk01212  Fatty acid metabolism
Module
pmk_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MDS_2614
   00650 Butanoate metabolism
    MDS_2614
  Lipid metabolism
   00071 Fatty acid degradation
    MDS_2614
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MDS_2614
   00310 Lysine degradation
    MDS_2614
   00360 Phenylalanine metabolism
    MDS_2614
   00380 Tryptophan metabolism
    MDS_2614
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MDS_2614
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MDS_2614
   00281 Geraniol degradation
    MDS_2614
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MDS_2614
   00627 Aminobenzoate degradation
    MDS_2614
   00930 Caprolactam degradation
    MDS_2614
Enzymes [BR:pmk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MDS_2614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEB58645
UniProt: F4DWE6
Position
2860706..2861395
Genome map
AA seq 229 aa AA seqDB search
MSDLISYQLEDGIATLTLSNGKVNAISPDVIAAFNTALDRAEQDRAIVIITGQPGILSGG
YDLKVMTSGPQNAINLVAAGSNLARRMLAHPFPIIVACPGHAVAKGAFILLSSDYRIGVE
GPFSIGLNEVQIGMTMHHVGIELARDRLRKSAFHRSVINGEMFDPAAAVDAGFLDKVVPA
EQLLATAQAAAQQMKKINMTAHKNTKLKVRKALLEILDAAIEMDKQHLM
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacctgatcagctatcaactcgaagacggcatcgccaccctcaccctgagcaat
ggcaaggtcaatgccatctcgcccgatgtgatcgccgccttcaatactgcgctcgaccgc
gcggaacaggatcgcgccatcgtcatcatcaccggtcagccaggcattctttccggcggc
tacgacctgaaagtaatgacctccggcccgcagaacgcgatcaacctggtagccgctggt
tccaacctggcgcggcgcatgctcgcccaccccttcccgataattgtggcctgccctggt
cacgccgtggccaagggtgccttcatcctgctgtcgagcgattaccgtatcggcgtcgag
ggcccgttcagcatcggcctgaacgaagttcagatcggcatgaccatgcatcatgtcggt
atcgagctggcccgtgaccgcctgcgcaagtcagccttccaccgctcggtgatcaatggc
gagatgttcgatccggcggcagccgtagatgccggctttctggacaaggtggtaccggca
gagcaattgctggccaccgcccaggcggcagcgcagcagatgaagaagataaatatgacc
gcgcacaagaacaccaagctgaaagtgcgcaaggcgttgctggaaatcctcgatgccgcc
atcgagatggacaagcagcatctgatgtaa

DBGET integrated database retrieval system