KEGG   Pseudomonas mendocina NK-01: MDS_2667Help
Entry
MDS_2667          CDS       T01473                                 

Definition
lysophospholipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    MDS_2667
Enzymes [BR:pmk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     MDS_2667
   3.1.2  Thioester hydrolases
    3.1.2.-  
     MDS_2667
Lipid biosynthesis proteins [BR:pmk01004]
 Fatty acid synthase
  Component type
   MDS_2667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2920661..2921266)
Genome map
AA seq 201 aa AA seqDB search
MRAWWLSGALTLMFWAHGAVAGTLLVVGDSISAAFGLDSRQGWVALLENRLKEEGFEHSV
VNASISGDTSAGGAARLSALLAEHKPELVIIELGGNDGLRGQPPAQLQQNLASMIDASQA
SGAKVLLLGMRLPPNYGARYTSAFAQVFADLAERKQVPLVPFFLEGVGGVPGMMQADGIH
PTQDAQAVLLDNVWPTLEPML
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcatggtggctcagtggtgccttgaccctgatgttctgggctcatggagcggtt
gcaggcaccctgcttgtggtcggcgatagtatcagcgccgcttttggcctggatagccgc
cagggatgggtcgcgttgctggaaaatcgcctcaaggaagagggtttcgagcactcggtg
gtcaatgcctcgatcagcggcgataccagcgcaggcggcgccgcgcggctgtctgcgcta
cttgccgagcacaaaccggagctggtcatcatcgagctgggcggcaatgatggcctgcgt
ggccaaccccctgcgcaattgcaacagaatcttgcgtcgatgatcgacgcatcgcaggcg
tccggtgccaaggtactgctcctggggatgcgcttgccgcccaactatggcgcgcgttac
acctccgctttcgcccaggtgttcgccgacctggccgagcggaagcaggttccactggtg
ccgttcttcctcgagggtgtcgggggcgtgccggggatgatgcaggccgacggcattcat
ccgactcaggacgcacaggctgtgctgcttgataacgtctggccgacgctcgaacccatg
ctgtga

DBGET integrated database retrieval system