KEGG   Pseudomonas mendocina NK-01: MDS_2690Help
Entry
MDS_2690          CDS       T01473                                 

Definition
gamma-carboxygeranoyl-CoA hydratase
Orthology
K13766  
methylglutaconyl-CoA hydratase [EC:4.2.1.18]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:pmk00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2951489..2952283
Genome map
AA seq 264 aa AA seqDB search
MTDFTTVQLEKDPRGFATLWLNRPEKNNAFNAEMIRELILALDAVGEDKSLRFLLLRGRG
KHFSAGADLAWMQHAATLDYNANLNDARELAELMYNLHGLKIPTLAVVQGAAFGGAVGLA
SCCDMAIGSEDALFSLSEVRIGLAPAVISPFVVQAIGERAAKRYALTAERFDGKRARELG
LLAECFPLAELDAQVEAWVANLLHNSPQAMRASKDLLREVGSGELTPALRRYTENAIARL
RVSAEGQEGLRAFLEKRQPSWQEQ
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacttcaccaccgtacagcttgagaaagacccgcgcggcttcgccaccctgtgg
ctgaaccgcccggagaagaacaacgccttcaacgccgagatgatccgcgagctgatcctc
gccctcgacgccgtgggcgaagacaagagcctgcgctttctcctgttgcgcgggcgcggc
aagcacttttccgctggcgccgacctggcctggatgcagcacgccgccaccctcgactac
aacgccaatttgaatgacgcccgcgagctggccgagctgatgtacaacctgcacggtctg
aagatccccaccctggccgtcgtccagggcgcggccttcggtggtgcggtgggtctggcc
agttgctgcgacatggccatcggcagcgaagacgcgctgttctcgctgtcggaagtgcgt
atcggcctggccccggcggtgatcagccccttcgtcgtgcaggccatcggcgagcgcgcc
gccaagcgctacgcgctcaccgccgagcgcttcgatggcaagcgcgcccgcgaactgggc
ctgcttgccgagtgcttcccgcttgccgaattggatgctcaggtcgaagcctgggtcgcc
aacctgctgcacaacagcccgcaagccatgcgcgccagcaaggatctgctgcgcgaagtc
ggcagcggcgagctgaccccggccctgcgccgctacaccgagaacgccatcgcccgcctg
cgcgtcagcgccgagggccaggaaggcctgcgcgcattcctggaaaaacgccaaccgtcc
tggcaggagcaatga

DBGET integrated database retrieval system