KEGG   Pseudomonas mendocina NK-01: MDS_2770Help
Entry
MDS_2770          CDS       T01473                                 

Definition
DNA helicase/exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pmk03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3045122..3047152)
Genome map
AA seq 676 aa AA seqDB search
MSTTLAPALLDRAELFALLSTWSERGWLRELDRALAQLFAELDPQASPLLLLGAALASHQ
LGRGHVCLDLAATLANPDFTLSLPPEGDDVEESMILPSQVLAGLSLESWLAACAGSALLE
SEGAPLVLSGTCLYMRRYWNYERQVAYNIAQRLQTSAAAPTDLAARLASLFPEALMVSGQ
RLTDWQKLACAMAAQGRFTLITGGPGTGKTTTVVRLLALLQEAAMATGEPLRLSLAAPTG
KAAARLTESIGAQVQSLALDERVREQIPTLVTTLHRLLGSRPGSRHFRHDATNPLPLDVL
VVDEASMIDLEMMASLLDALPTHARLILLGDKDQLASVEAGAVLGDLCREAESGGYSEAT
RVWLESQTGERLDDPALVISDKALAQHIVMLRHSRRFGSGSGIGRLARAVNQGDAQMARA
TLAGGADDLHVLRLSGEQDRGLGRLLIDGQGAGESRPQGYAHYLQVMQAQRPTSDAGEQA
WDEWAGKVLAAFDQFQLLCAVRKGAWGVEALNERIAEALVRRKLLEQAYGWYEGRPVLVT
RNDYSLGLMNGDIGIALRLPEPPESPGAPVREVLRVVFPRNDGSGTLRHILPSRLSAVET
VFAMTVHKSQGSEFAHCALILPDSLNPVLTKELVYTGITRARHWFSLIESRAGIFEQAVQ
RRVERRSGLREALEAL
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgactcttgcgccagcgctgcttgatcgcgctgaactcttcgccctgctttcc
acctggagcgagcgtggctggttgcgcgagttggatcgggcgctggcgcagctgttcgcc
gagctggatccgcaggcttcaccgctgcttctgctcggtgccgcgttggccagtcaccag
ttgggtcgggggcatgtctgcttggatctggcagccaccttggccaacccggacttcact
ctatccctgccaccggagggggatgatgtggaagagtcgatgatcctgccgtcccaggtg
ctggcgggactcagcctggaatcctggttggcggcctgtgccggcagcgcgctgctggag
tccgaaggtgcgccgttggtgcttagcggcacttgcttatatatgcggcgttactggaac
tacgagcgccaggtggcctacaacatcgcccagcgtctgcagacgagcgctgcagcaccg
accgatctggccgcgcgccttgcttcactctttcccgaggcgctgatggtgagcggtcag
cgcctgaccgactggcagaagctggcctgcgccatggccgcacagggccgtttcacgctg
atcactggcgggccgggaaccggcaagacgaccacggtggtgcgcctgctggcattgttg
caggaagctgccatggccactggtgagccgctgcgcctgagcctggcggcgcccaccggc
aaggcggctgcacggttgaccgagtccatcggcgcacaagtacagtcgctggcgttggac
gagcgcgtgcgagagcagattccgacgctggtaacgacgctgcaccgcttgctgggcagt
cgtcccggcagtcgtcattttcgtcatgatgctactaaccccctgccgctggacgtgctt
gtagtcgacgaggcatcgatgatcgacctggaaatgatggccagcctgctggacgcactg
ccgacgcatgcgcgtctgattctgctgggtgacaaggatcagctcgcttcggtagaggct
ggcgcggtgttgggcgatctctgccgggaggcggagagcggtggctacagtgaggcgacg
cgagtctggctggaaagccagacgggcgagcggctggacgaccccgcactggtcattagt
gacaaggcgctggcccaacacattgtcatgctgcgtcactcgcgccgcttcggcagtggc
tcaggtatcgggcgtttggcgcgtgcggtgaaccagggcgatgcgcaaatggctcgtgcg
actttggcgggcggtgcggatgacctgcatgtgttgcgcctgtctggggagcaggatcgc
ggattgggacgtctcctcatcgacgggcagggcgccggtgagtcgcggccgcaggggtat
gcccattacctacaagtgatgcaggcgcagcgccccacgtcagatgcgggtgagcaagcc
tgggacgaatgggctggcaaggttttggcggcattcgatcagttccagttgctgtgcgcc
gttcgcaagggcgcctggggtgtggaggctctcaacgaacgtatcgccgaagcgctggtg
cgccgtaagctgctggagcaagcatatggctggtatgaggggaggccagtgctggtaacg
cgcaatgactacagcctgggattgatgaatggcgatatcggtattgcgctgcgcctaccg
gagccgcctgaatctccgggcgcgcctgtacgggaggtattgcgagtggtattcccgcgt
aatgatggtagtggcaccttgcgccacatcttgccgagtcgcctgagtgcggtggagaca
gtgttcgccatgaccgtgcacaagtcgcagggctccgagttcgctcattgcgcgctgatc
ctgcctgatagtctcaatccagtgctgaccaaggagctggtctataccggcatcacccgg
gcgcgccattggttcagccttatagagagccgtgccggcatcttcgagcaggctgtgcag
cgacgtgtggagcggcgtagcggtctgcgcgaggcgctcgaagcgctgtaa

DBGET integrated database retrieval system