KEGG   Pseudomonas mendocina NK-01: MDS_2770Help
Entry
MDS_2770          CDS       T01473                                 

Definition
DNA helicase/exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MDS_2770
Enzymes [BR:pmk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MDS_2770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3045122..3047152)
Genome map
AA seq 676 aa AA seqDB search
MSTTLAPALLDRAELFALLSTWSERGWLRELDRALAQLFAELDPQASPLLLLGAALASHQ
LGRGHVCLDLAATLANPDFTLSLPPEGDDVEESMILPSQVLAGLSLESWLAACAGSALLE
SEGAPLVLSGTCLYMRRYWNYERQVAYNIAQRLQTSAAAPTDLAARLASLFPEALMVSGQ
RLTDWQKLACAMAAQGRFTLITGGPGTGKTTTVVRLLALLQEAAMATGEPLRLSLAAPTG
KAAARLTESIGAQVQSLALDERVREQIPTLVTTLHRLLGSRPGSRHFRHDATNPLPLDVL
VVDEASMIDLEMMASLLDALPTHARLILLGDKDQLASVEAGAVLGDLCREAESGGYSEAT
RVWLESQTGERLDDPALVISDKALAQHIVMLRHSRRFGSGSGIGRLARAVNQGDAQMARA
TLAGGADDLHVLRLSGEQDRGLGRLLIDGQGAGESRPQGYAHYLQVMQAQRPTSDAGEQA
WDEWAGKVLAAFDQFQLLCAVRKGAWGVEALNERIAEALVRRKLLEQAYGWYEGRPVLVT
RNDYSLGLMNGDIGIALRLPEPPESPGAPVREVLRVVFPRNDGSGTLRHILPSRLSAVET
VFAMTVHKSQGSEFAHCALILPDSLNPVLTKELVYTGITRARHWFSLIESRAGIFEQAVQ
RRVERRSGLREALEAL
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgactcttgcgccagcgctgcttgatcgcgctgaactcttcgccctgctttcc
acctggagcgagcgtggctggttgcgcgagttggatcgggcgctggcgcagctgttcgcc
gagctggatccgcaggcttcaccgctgcttctgctcggtgccgcgttggccagtcaccag
ttgggtcgggggcatgtctgcttggatctggcagccaccttggccaacccggacttcact
ctatccctgccaccggagggggatgatgtggaagagtcgatgatcctgccgtcccaggtg
ctggcgggactcagcctggaatcctggttggcggcctgtgccggcagcgcgctgctggag
tccgaaggtgcgccgttggtgcttagcggcacttgcttatatatgcggcgttactggaac
tacgagcgccaggtggcctacaacatcgcccagcgtctgcagacgagcgctgcagcaccg
accgatctggccgcgcgccttgcttcactctttcccgaggcgctgatggtgagcggtcag
cgcctgaccgactggcagaagctggcctgcgccatggccgcacagggccgtttcacgctg
atcactggcgggccgggaaccggcaagacgaccacggtggtgcgcctgctggcattgttg
caggaagctgccatggccactggtgagccgctgcgcctgagcctggcggcgcccaccggc
aaggcggctgcacggttgaccgagtccatcggcgcacaagtacagtcgctggcgttggac
gagcgcgtgcgagagcagattccgacgctggtaacgacgctgcaccgcttgctgggcagt
cgtcccggcagtcgtcattttcgtcatgatgctactaaccccctgccgctggacgtgctt
gtagtcgacgaggcatcgatgatcgacctggaaatgatggccagcctgctggacgcactg
ccgacgcatgcgcgtctgattctgctgggtgacaaggatcagctcgcttcggtagaggct
ggcgcggtgttgggcgatctctgccgggaggcggagagcggtggctacagtgaggcgacg
cgagtctggctggaaagccagacgggcgagcggctggacgaccccgcactggtcattagt
gacaaggcgctggcccaacacattgtcatgctgcgtcactcgcgccgcttcggcagtggc
tcaggtatcgggcgtttggcgcgtgcggtgaaccagggcgatgcgcaaatggctcgtgcg
actttggcgggcggtgcggatgacctgcatgtgttgcgcctgtctggggagcaggatcgc
ggattgggacgtctcctcatcgacgggcagggcgccggtgagtcgcggccgcaggggtat
gcccattacctacaagtgatgcaggcgcagcgccccacgtcagatgcgggtgagcaagcc
tgggacgaatgggctggcaaggttttggcggcattcgatcagttccagttgctgtgcgcc
gttcgcaagggcgcctggggtgtggaggctctcaacgaacgtatcgccgaagcgctggtg
cgccgtaagctgctggagcaagcatatggctggtatgaggggaggccagtgctggtaacg
cgcaatgactacagcctgggattgatgaatggcgatatcggtattgcgctgcgcctaccg
gagccgcctgaatctccgggcgcgcctgtacgggaggtattgcgagtggtattcccgcgt
aatgatggtagtggcaccttgcgccacatcttgccgagtcgcctgagtgcggtggagaca
gtgttcgccatgaccgtgcacaagtcgcagggctccgagttcgctcattgcgcgctgatc
ctgcctgatagtctcaatccagtgctgaccaaggagctggtctataccggcatcacccgg
gcgcgccattggttcagccttatagagagccgtgccggcatcttcgagcaggctgtgcag
cgacgtgtggagcggcgtagcggtctgcgcgaggcgctcgaagcgctgtaa

DBGET integrated database retrieval system