KEGG   Pseudomonas mendocina NK-01: MDS_2772Help
Entry
MDS_2772          CDS       T01473                                 

Definition
DNA helicase/exodeoxyribonuclease V subunit gamma
Orthology
K03583  
exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pmk03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3050775..3054191)
Genome map
AA seq 1138 aa AA seqDB search
MPASPELSPGLIVIHGNHLEELRTLAVQWMRRYPLRPLENEVLLVQSNGIAQWLKLALAE
RDGCGIAAALDVDLPARFLWQAYRNVLGKDAIPQQSPLDKAPLTWRLMRLLPGLLAEEAF
APLRRFLADDQDLRKRHQLAERLADLFDQYQVYRADWLADWAAAHDRLRTSRGGERILDD
DSRWQPALWRALLADVGEQHLAESRAGVHPRFVARMGELDAAPPGLPRRITVFGISSLPA
QVLEALAAMARFSQVMLYVHNPCQHHWGDIVEDKDLLRHEYRRQQRKGKPSAQIGLFEQE
DMHQHGQPLLAAWGKQGRDYINLLDQYDEPQRYREQFERIDLFSPASECCLLGQLQNDIL
DLRPLADTRSTWPPVDPARDHSLRFHVAHSAQREVEVLHDQLLASFSEDSTLRPRDVIVM
VPDVNAYAPHIQAVFGQFASDDPRFIPFTLADQGLRGKEPMVIALEHLLRLPDSRFSVSE
ILDLLDVAALRERFAIAEDQLPTLRRWLEGAGVRWGLDASQRQSLGLGENLEQNTWRFGL
RRMLLGYAVGKADAFAGIEPYDEIGGLDAALIGPVTRLLETLDQHLQLMREPTTPVQWGE
RLRSLLDGFFLAQNDREEVLTTQLLDALDAWLELCEAATLDEALTLPVVREAWLGGLDQG
RLSQRFLAGAVNFCTLMPMRAIPFRQVCLLGMNDGDYPRSQAPLDFDLMAGDYRPGDRSR
REDDRYLLLEALLAARDRLYISWVGRSIRDNSERPPSVLVGQLRDHLASAWTLAGGGDLL
HGLTTEHPLQPFSRRYFDGEAQLFSYAREWAALHGHALAGENFVAPLPAWEEGRQLTPEL
LQSFLRDPVKCFFTRRLKVFLDEDEQAQLDSEPFALDGLQRYQLQETLLKAAVAGDVDSD
DALRAAADRLQRSGVLPLAGFGEQYRNALLEPLPAQLRRYQGLCLCWPTPVESPQRLLFS
AAGVDLDGWLAGLRQKADGSLARLELLPGALHKDKSWKWHRLLRPYVLHVIAAACGVPLT
TLLVGEDRSLVFDPLPAEHAAHVLTAWLEAWNLGMQSPLPVALKTSLTWLQDNNEDKASS
VYEGGYNLTGEVQGSASLARQFPDYSALSADGQFPAWSERLYQPLLDSHPQALEEDAA
NT seq 3417 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccagcccggagctgtcccccggccttatcgtcattcacggtaaccacctcgaa
gagttgcgcactctggcggtacagtggatgcggcgctatccattgcggcctctggagaac
gaggtgctgctggtgcagagcaatggcatcgcccagtggctcaagctggcgctggccgag
cgtgacggctgcggcattgctgcggcgctggatgtcgatctgccggcgcgctttctctgg
caggcgtaccgcaacgtattgggtaaggatgcgattccgcagcagtcgccgctggacaag
gcgccgctgacctggcgcctgatgcggctgttgccgggtttgctggcggaggaagcgttc
gcccctttgcgccgcttcctcgccgatgatcaggatctgcgcaagcgtcaccaactggca
gagcgtctggccgatctgttcgaccaataccaggtctatcgcgctgactggctggcggac
tgggccgccgcgcatgaccgtttgcgtacctcgcgcggtggcgagcggattctggacgat
gattcccgttggcagcccgcgctgtggcgcgccttgctggcggatgtcggcgagcagcat
ctggccgagagccgcgccggcgtgcatccgcgcttcgtcgcgcgcatgggcgagctggat
gcagcgccgcccgggctgccgcggcgcatcaccgttttcggtatttcctcattaccggct
caggtgctggaagcgctggcggccatggcgcgtttcagtcaggtcatgctctacgtgcac
aacccttgtcagcaccattggggcgatatcgtcgaagacaaggatctgctgcgtcacgag
taccgtcgccagcagcgcaagggcaagcccagcgcccagatcggcctgttcgaacaggag
gacatgcaccagcacgggcagccgctgctggcggcctggggcaagcaggggcgcgactat
atcaacctgctggatcagtacgacgagccgcagcgttaccgcgagcagttcgaacgcatc
gacctgttcagtccggccagcgagtgctgtctgctcggccagttgcagaatgacatcctc
gacctgcgtccgctggcggacacgcgcagcacctggccaccggtcgatccggcgcgtgat
cactcactgcgctttcatgtcgcccacagcgcccagcgtgaggtggaggtgctgcatgac
cagttgctggctagcttcagtgaggactccacactaaggccgcgcgacgtgatcgtcatg
gtacctgacgtcaacgcctatgcgccgcatatccaggccgtgttcggccagttcgccagt
gacgatccgcgtttcattcccttcaccctggccgaccaggggctgcgcggcaaggagccg
atggtcattgcgctggagcacctgctgcgcctgccggacagtcgcttcagcgtcagcgag
attctcgatctgctggatgtcgcggcgctacgcgaacgcttcgccatcgccgaggatcag
ctgccgacgttgcgccgctggctggagggtgccggtgtgcgttgggggctggatgcgagc
cagcggcaatcgctgggcctcggcgagaatctggagcagaacacctggcgcttcggcctg
cggcgcatgctgctgggctacgcagtgggcaaggccgacgcctttgccggtattgagccc
tatgacgagatcggcgggcttgatgctgcgctgatcggcccggtgacgcgcctgctggaa
actctcgaccagcatctgcagctaatgcgtgagccgaccacgccagtgcagtggggcgaa
cgcttgcgcagtctgcttgatggcttcttccttgcgcagaacgaccgtgaagaagtgctc
acgactcaactgctcgatgcactggacgcctggctggagctgtgcgaggccgccacgctg
gacgaagcgctgaccctgccagtggtgcgcgaagcgtggctcggcgggctcgatcagggc
cggttgagtcagcgttttctcgccggtgcagtaaatttctgcaccctgatgccgatgcgc
gcgatcccgtttcgccaggtctgcctgctgggcatgaacgatggcgactatccgcgcagc
caggccccgctggatttcgacctgatggctggcgattaccgtcccggtgaccgctcacgc
cgtgaggatgaccgctatttgctgctggaagcgttgctggcggcgcgtgatcgcctttat
atcagctgggtagggcgcagcattcgcgacaacagcgagcggccgccgtccgtgttggtc
ggtcagttgcgcgaccatcttgccagtgcctggacactggctggtggcggcgacctgctg
catggtctgaccaccgagcacccactgcagcccttcagtcgtcgctacttcgatggtgag
gcgcagttgttcagttatgcccgcgagtgggccgccctgcatggccatgcgttggcggga
gaaaactttgttgcacccttaccagcctgggaggaggggaggcagcttacgcctgagcta
ttgcagtcgttcctgcgtgatccggtgaagtgtttcttcacccgccgcctgaaggtgttt
ctcgatgaagacgagcaggcgcaactcgacagtgagccatttgcccttgacggtctgcag
cgctatcagttgcaggaaaccttgctaaaggccgccgtcgcaggcgatgtggatagcgac
gatgcgctaagggcggcagccgaccgtctgcaacgtagtggtgtcctgccgctggccggt
ttcggcgagcaatatcgcaatgccctgctggagcctctgccggcgcagttgcggcgttat
caggggctctgcctgtgctggccgacgccggtcgagtcgccacagcgtctgctcttcagt
gcagccggtgttgatctcgatggctggctcgccgggttgcggcagaaggccgacggtagc
ctggcgcgcctggagctgctgccgggcgcattgcacaaggacaagagctggaaatggcat
cgtctgctgcggccctatgtactgcacgtcatcgccgcggcctgtggtgtgccgctgacc
accttgctggtcggtgaggatcgtagtctcgtgttcgaccccctgcctgcggagcacgca
gcccatgtactgaccgcttggctggaggcctggaatctgggtatgcagtcgccgttgccg
gtcgcgctgaaaacctcgttgacctggttgcaggacaacaacgaggacaaggccagcagc
gtctacgaggggggctacaacctcaccggtgaagtccagggcagcgccagtctggctagg
cagttcccggactactctgcgctcagcgccgatggccagtttccggcatggagtgagcgg
ctttaccagccgctgctcgatagtcatccccaggcgctcgaggaggacgcagcatga

DBGET integrated database retrieval system