KEGG   Pseudomonas mendocina NK-01: MDS_2894Help
Entry
MDS_2894          CDS       T01473                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MDS_2894
Enzymes [BR:pmk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     MDS_2894
Peptidases [BR:pmk01002]
 Cysteine Peptidases
  Family C44
   MDS_2894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3195937..3197790
Genome map
AA seq 617 aa AA seqDB search
MCGITGWLSYSQNLETQRDTLQRMTDTMALRGPDAGGLWINGPVGLGHRRLSIIDLEGGR
QPMTAMHGGPREAAAITYSGEVYNFRELRTELQRLGHRFETRSDTEVVLRAYVEWGEAFV
EQLNGMYAFAIWDLRSQELLLIRDRMGVKPLYYFPTADGVVFGSEPKALLANPLVPRKVR
ADGLREILEMVKTPGHAVFDGMREVMPGEIVRINRQGLGRRHYWKLQAREHEHTLDETIR
HTRDLLEDIVDRQIVADVPLCSLLSGGLDSSIITALASKKLLAAGKENIRSFSVDFVDHG
SGFTGDAVRGTPDAPFVRDLVEKISSSHQEIVLDSRELADPALRAQIVRALDLPPAFWGD
MWPSLYRLFQEVRKHSTVALSGESADEVFGGYRWFHDPEAIQADTFPWLASVTGKYFDGK
TLFDPGLLAQLDMHSFLRDSYAQAIAEAPVLPGESAVDQRMRQMSYVNLTRFVQTLLDRK
DRMSMAVGLEVRVPFCDHRLVEYAFNIPWAMKAFDGREKSILRAATRDLLPESISERVKS
PYPSTQDPAYEQALRDALAAIQADRNAPVTPLLDSGRIQQTLAKPLGGVSPMYERMGMEL
AVGLNTWLNEYDVSLEL
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatcactggatggctgtcttacagccagaacctggaaacgcaacgcgacacc
ctgcagcgcatgaccgacaccatggccctgcgcgggccggatgctggcggactgtggatc
aacggaccggttggcctgggccatcggcgcctgtcgatcatcgacctggagggcgggcgc
cagccgatgacggcgatgcacggcggtccgcgcgaagccgccgccatcacctacagcggc
gaggtctacaacttccgcgagctgcgcaccgagctgcaacgtctcggccaccgcttcgag
actcgcagcgacaccgaggtggtgctgcgcgcctatgtcgaatggggcgaagccttcgtc
gagcaactcaacggcatgtatgccttcgccatctgggatctgcgttcgcaagagctgctg
ctgatccgcgaccgcatgggcgtcaagccgttgtactacttccctactgcagacggcgtg
gtgttcggctccgagcccaaggcgttgctggccaatccgctggtgccgcgcaaggtgcgc
gccgatggcttgcgcgagatcttggagatggtgaagacgccaggccacgccgtgttcgat
ggcatgcgcgaggtgatgccgggcgagatcgtgcgaatcaaccgccaaggcctaggccgc
cgccactactggaagctgcaggcgcgcgagcacgagcacacgctggacgagaccatccgc
catacccgcgacctgctggaggacatcgtagatcgccagatcgtcgccgacgtaccgctg
tgcagcctgctctcgggcggcctggactcctcgatcatcaccgcgctggcctcgaagaag
ctgctggccgccggcaaggagaacatccgctccttctccgtcgacttcgtcgaccacggc
agcggcttcaccggcgacgccgtacgcggtacgcccgatgcgcccttcgtgcgcgacctg
gtggagaagatcagctccagtcaccaggagatcgtcctcgacagccgcgagctggccgat
ccggcgttgcgtgcgcagatcgttcgcgccctcgacctgccaccggccttctggggcgac
atgtggccatcgctctaccgactgttccaggaggtgcgcaagcactcgacggtggcgctg
tccggcgagagcgcggacgaggtgttcggtggctaccgctggttccacgatccggaggcg
atccaggccgataccttcccctggctggcctcggtcaccggcaagtacttcgacggcaag
accctgttcgacccgggcctgctggcccaactggacatgcacagcttcctgcgcgacagc
tacgcccaggccatcgccgaagcgccggtactgcccggcgagagcgcggtcgaccagcgc
atgcggcagatgagctacgtcaacctgacccgcttcgtgcagaccctgctcgaccgcaag
gatcgcatgagcatggccgtgggcctcgaggtacgggtgcccttctgcgaccaccgcctg
gtcgagtacgccttcaacatcccctgggcgatgaaggccttcgacgggcgggagaaaagc
atcctgcgcgcggcgacccgcgacctgctgcccgaatcgatcagcgagcgggtcaagagc
ccctacccctcgacgcaggatccggcctacgagcaggcgctgcgtgacgccctggccgcc
atccaggcggatcgcaatgcgccggtgacgcccctgctcgacagcggccgtatccagcaa
accttggccaagccgctcggcggtgtctcgcccatgtacgaacgcatgggcatggagctg
gcggtcggcctcaacacctggctgaacgagtacgacgtcagcctcgaactctag

DBGET integrated database retrieval system