KEGG   Pseudomonas mendocina NK-01: MDS_2989Help
Entry
MDS_2989          CDS       T01473                                 

Definition
peroxiredoxin
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    MDS_2989
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MDS_2989
Enzymes [BR:pmk01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MDS_2989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3298094..3298579)
Genome map
AA seq 161 aa AA seqDB search
MSNALFDIPVTTIKGEQKTLADFGGKAVLVVNTASKCGFTPQYKGLENVWQQYKDKGLVV
LGFPCNQFGKQEPGDEGAISEFCELNFGVSFPLFKKVDVNGADAHPLFVQLKKRAPGLLG
SQGIKWNFTKFLIGKDGQVVKRFAPTTKPEELSSEIEALLK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgcgcttttcgatatcccggtcaccaccatcaagggcgagcagaagactctg
gccgacttcggtggcaaggccgtactggtggtcaacaccgccagcaagtgcggtttcacc
ccgcagtacaagggcctggagaacgtctggcagcaatacaaggacaagggccttgtggtg
ctgggctttccctgcaaccagttcggcaagcaggagccgggtgacgagggcgccatctcg
gagttctgcgagctgaacttcggcgtcagcttcccgctgttcaagaaggtcgacgtcaac
ggcgccgatgcccatccgctgttcgtgcagctgaaaaagcgtgcgcccggcctgctgggt
agtcagggtatcaaatggaacttcaccaagttcctgatcggcaaggatggccaggtggtc
aagcgcttcgccccgaccaccaagccggaagaactgagcagcgagatcgaagcgctgctg
aaatga

DBGET integrated database retrieval system