KEGG   Pseudomonas mendocina NK-01: MDS_3300Help
Entry
MDS_3300          CDS       T01473                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pmk  Pseudomonas mendocina NK-01
Brite
Enzymes [BR:pmk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     MDS_3300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3650752..3651426)
Genome map
AA seq 224 aa AA seqDB search
MRGQDDMQRSGIGMTSQRTRERLIQRLYEEGLSNARVLEVIRRTPRHLFVDEALAHRAYE
DTALPIGHNQTISQPYMVGRMTELLLAAGPLDKVLEIGTGSGYQTAVLAQLVERVFSVER
IQVLQDRAKERLAELKLRNVVFRWGDGWEGWNALGPYNGIIVTAAAAQVPQALLDQLAPG
GRLVIPVGSGDVQQLLLIVREEDGFSRHVLDAVRFVPLLNGPLA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggccaggacgacatgcagcgcagcgggatcggcatgacctcgcagcgcacccgt
gaacgattgatccagcgcctctatgaggaagggctgtcgaacgcgcgcgtactggaagta
atccgccgtaccccgcgtcacctgttcgtcgatgaggcgctggcgcaccgtgcctatgaa
gacactgcgctgcccatcgggcataaccagaccatttcccagccgtacatggtcggtcgc
atgaccgagctgttgctggcggccgggccgctggacaaggttctggagatcggtactggc
tccggctaccagaccgccgtgctggcgcaactggtggagcgggtgttctcggtggagcgc
attcaggtgctgcaggaccgagccaaggagcgtctggccgaactcaagttgcgcaacgtg
gtctttcgctggggggacggctgggaaggctggaatgcgctcggcccgtacaacggcatc
atcgtcacggctgccgccgcgcaggtgccacaggccctgctcgatcagctggcgccaggt
ggacgcctggtcattccggtgggcagcggcgatgtgcagcaattgctgctgatcgtgcgt
gaagaggatggtttttcccgtcatgtgctggacgcggtgcgcttcgtgccgctactcaac
gggccgctggcctga

DBGET integrated database retrieval system