KEGG   Pseudomonas mendocina NK-01: MDS_3344Help
Entry
MDS_3344          CDS       T01473                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pmk01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pmk00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3698656..3699798
Genome map
AA seq 380 aa AA seqDB search
MTPTLTPTLELAFDLIRRPSVTPVDEGCQELMMRRLAACGFEVERMRIEEVENFWAKRGG
DGPVLCFAGHTDVVPTGPLDAWQYQPFDVRVDEEGMLCGRGAADMKGSLASMIIAVERFV
AEHPNHKGAISFLITSDEEGPAQHGTKAVVERLRERGERLDWCIVGEPSSTSLLGDVVKN
GRRGSLGCTLTVYGKQGHVAYPHLAKNPIHLAAPALAELAAEHWDHGNDYFPPTSFQVSN
LNSGTGATNVIPGELKAVFNFRFSTESTVEGLQQRVTAILDKHGLDYHLEWALSGLPFLT
QPGDLLDAVAASIKNVTGRDTTPSTSGGTSDGRFIATLGTQVVELGPVNATIHQINERVL
ASDLDLLTEVYYQTMVKLLA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgacccccaccctcaccccgaccctggaactcgccttcgacctgattcgtcgcccgtcc
gtgaccccggtcgacgaaggctgccaggagctgatgatgcgccgcctggctgcctgcggt
ttcgaggtggagcgcatgcgcatcgaagaggtggagaatttctgggccaaacgcggtggc
gacggcccggtgctgtgcttcgccggccacaccgatgtggtgcccaccggcccgctggac
gcctggcagtaccagccgttcgacgtgcgcgtggacgaagaaggcatgctctgcggccgt
ggcgcggcggacatgaaaggcagcctggcgagcatgatcatcgccgtcgagcgcttcgtc
gcagagcatccgaaccataagggcgcgatcagcttcctgatcaccagcgacgaggaaggc
ccggcgcagcatggcaccaaggccgtggtcgagcgcctgcgcgaacgcggcgagcgcctg
gactggtgcatcgtcggcgagccgtcgagcaccagcctgcttggtgacgtggtcaagaac
gggcgccgcggctcgctcggctgcaccctcaccgtctacggcaagcagggccatgtcgcc
tacccgcatctggcgaagaacccgattcatctcgctgccccggccctggccgaactggcc
gccgagcactgggatcacggcaacgattacttcccgccgaccagcttccaggtgtccaac
ctcaactcgggcaccggcgccaccaacgttatcccaggtgaactgaaggcggtgttcaac
ttccgcttctccaccgaatccaccgtcgaaggcctgcagcagcgcgtcaccgccattctc
gacaagcatggcctggactatcacctggagtgggcgctgtccggcctgcctttcctcacc
caaccgggtgacctgctcgacgccgtagccgccagcatcaagaacgtcaccggccgcgac
accaccccctcgaccagcggcggtacttccgatgggcgctttatcgctaccctgggcacc
caggtggtcgagcttggcccggtcaacgccaccattcaccagatcaacgaacgcgtgctg
gccagcgatctcgatctgctcaccgaggtttattaccagaccatggtgaaactcctcgca
tga

DBGET integrated database retrieval system