KEGG   Pseudomonas mendocina NK-01: MDS_3377Help
Entry
MDS_3377          CDS       T01473                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MDS_3377
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MDS_3377
   00052 Galactose metabolism
    MDS_3377
   00500 Starch and sucrose metabolism
    MDS_3377
   00520 Amino sugar and nucleotide sugar metabolism
    MDS_3377
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MDS_3377
   00524 Butirosin and neomycin biosynthesis
    MDS_3377
Enzymes [BR:pmk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MDS_3377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3735790..3736752)
Genome map
AA seq 320 aa AA seqDB search
MKLALVGDIGGTNARFALWRDDHLEAVQVLATADFPGPEQAIMAYLQAQGLPLGAIGSVC
LACAGPVSGDLFRFTNNHWRIDRTAFCQALQVDELLMINDFFAMALGMTRLAEHERIPVC
EGQAQAERPVLVIGAGTGLGVGTLLEQADGRWLVLPGEGGHVDLPIGSPREAELWQILHR
QLGHVRAEDVLSGNGLLALYRAICELDGQPRRHDTPAAITTAGLAGESVAAEVLEQFSCW
LGRVAGNNVLTLGARGGVYIVGGVVPRFAERFLTSGFAKSFSDKGCMSHYLDGVPVWLVT
AEYPGLTGAGVALQQRAEAG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactggcgctggtcggcgacatcggtggaaccaacgcacgcttcgccctgtggcgt
gacgatcatctggaggcggtacaggtgctggcgaccgccgattttcccgggccggagcag
gccatcatggcctatctgcaggcccagggcctgccgttgggggcgataggctcggtgtgc
ctggcctgcgctgggccggtcagcggtgacctgttccgttttaccaacaaccattggcgc
atcgatcgcacagccttctgccaggcgttgcaggtcgacgagctgctgatgatcaacgat
ttcttcgccatggcgttgggcatgacccgcctggccgagcacgagcggataccagtgtgc
gagggccaggcgcaggcagagcggccggtgctggtgatcggcgccggtaccggtctgggc
gtcggtacgctgctggagcaggccgacggccgctggctggtgttgccgggggagggcggg
catgtcgacctgcccattggcagcccgcgtgaagccgagctgtggcagattctccatcga
caactggggcacgtaagggccgaagacgtgctcagcggcaatggcttgctggcgctttac
cgcgccatctgcgagctggacggccagccgcggcggcacgatacgccggctgcgatcacg
actgccggcctggcgggcgagtccgtcgctgccgaggtattggagcagttcagttgctgg
ctcgggcgcgtggccggcaacaatgtgctgacgctgggcgcgcgtggcggggtctacatc
gtcggcggcgtggtaccgcgttttgccgagcgttttctcaccagcggttttgccaagagt
ttcagcgacaagggctgcatgagccattaccttgacggcgtcccggtgtggctggtgacg
gccgagtatccaggcctgaccggcgccggcgtggccttgcaacagagggcagaggccggt
tag

DBGET integrated database retrieval system