KEGG   Pseudomonas mendocina NK-01: MDS_3590Help
Entry
MDS_3590          CDS       T01473                                 

Definition
short chain dehydrogenase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pmk00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:pmk00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3949695..3950405
Genome map
AA seq 236 aa AA seqDB search
MSAASFPILITGAGQRVGLYCAERLLDEGQSVIVSYRQERDGIARLRERGAIALQADFSD
ETSILSFIDSLKAQCSGLRAIVHNASDWLAETPGEEAEAFRQLFNVHMLAPYLINLHCSD
LLLQSTPADIVHVSDDVVRKGSANRPAYCASKAGLESLTLSFAARLAPRIKVNAIAPALL
MFNEGDDEAYRTKALAKSALGIEPGPHAFYQSLRYLLDNPYVTGTTLTLNGGRHLK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgccagcttccccatcctgatcaccggcgccggccagagggtaggtctatat
tgcgccgagcgcctgctcgacgaaggccagtcggtgatcgtcagctaccgccaggaacgc
gacggcatcgcgcgactgcgtgagcgcggtgccatcgctctacaagccgatttcagcgac
gagaccagcattctgtccttcatcgacagcctcaaggcgcaatgcagcggcctgcgcgcg
atcgtgcacaacgcctcagattggctggccgaaacacccggcgaagaagccgaggccttc
cgccagctattcaacgtgcacatgcttgcgccttacctgatcaatctgcattgcagcgac
ctgctgctgcagtcgacaccggccgacatcgttcacgtcagtgatgatgtggtgcgcaag
ggcagcgccaatcgccctgcctattgcgccagcaaggccggcctggagagcctgacgctt
tccttcgccgcgcgcctggcaccgcgtatcaaggtcaacgccatcgcgccggcgctgctg
atgttcaacgaaggtgatgatgaggcctaccgaaccaaggctttggccaaatcggcgctg
ggcatagaacccggcccgcacgccttctaccagagtttgcgctatctgctggacaacccc
tacgtaaccggaaccacccttaccctcaacggcggccgccacctcaagtga

DBGET integrated database retrieval system