KEGG   Pseudomonas mendocina NK-01: MDS_3591Help
Entry
MDS_3591          CDS       T01473                                 

Definition
GTP cyclohydrolase
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MDS_3591
Enzymes [BR:pmk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     MDS_3591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3950428..3950988
Genome map
AA seq 186 aa AA seqDB search
MSQPLSQQYREILVGLGENPEREGLLDTPKRAAKAMQYLCHGYQQSLEEIVNGALFESDN
DEMVIVKDIELYSLCEHHLLPFIGKAHVAYIPTGKVLGLSKVARIVDMYARRLQIQENLT
KQIADAIQKVTNAAGVAVVIEAKHMCMMMRGVEKQNSVMSSSVMLGAFRESCNTRHEFLQ
LIGRNN
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgagccaacctctttcccagcaataccgtgaaattctcgtaggcctcggtgaaaacccc
gagcgcgagggccttctcgacacaccgaaacgcgccgccaaggccatgcagtacctttgc
cacggctaccagcagtcgctggaggaaatcgtcaacggcgcgctgttcgagtccgacaac
gacgagatggtgatcgtcaaggacatcgaactgtactcgctgtgcgagcaccacctgctg
cccttcatcggcaaggcgcatgtcgcctacatccccaccggcaaggtgctggggctgtcc
aaggtagcgcgcatcgtcgacatgtatgcacgccgcctgcagatccaggagaacctcacc
aagcagatcgccgacgcgatccagaaggtgaccaacgccgctggcgtcgccgtggtgatc
gaggccaagcacatgtgcatgatgatgcgcggcgtcgagaaacagaactcggtgatgagc
agctcggtgatgcttggcgcgttccgcgagtcctgcaacactcgccatgaattcctgcaa
ttgatcggacggaacaactaa

DBGET integrated database retrieval system