KEGG   Pseudomonas mendocina NK-01: MDS_3670Help
Entry
MDS_3670          CDS       T01473                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    MDS_3670
Enzymes [BR:pmk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     MDS_3670
Exosome [BR:pmk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MDS_3670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4040246..4041733)
Genome map
AA seq 495 aa AA seqDB search
MSQYLLAIDQGTTSSRAIIFSAQGLPVARAQQEFKQYFPQDGWVEHDGQEIWLSTLKVCR
DAIASSGLQPEAIAAIGITNQRETTLVWDAKTGTPIHPAIVWQDRRTADYCAGLKEQGHE
AMVSAKTGLLIDPYFSATKLRWILRNVPGAQERAERGELRFGTVDSFLLWRLTDGKVHRT
DASNASRTLMFNIHTQQWDEELLELFGIPAGLLPEVLDCAAEFGHTERELLGASIPVLGM
AGDQQAALIGQACFEPGMVKSTYGTGCFMIQNTGEQPVTSKNRLLTTVGYRLDGKVTYAV
EGSIFVAGAAVQWLRDGIKLISHARESEALAEATGEACGVFLVPAFTGLGAPYWDPKARG
AIFGLTRDTGIKEIVTAGLQSVCYQTRDLLEAMRQDGAAAPSALRVDGGMVENNWVMQFL
ADILGVSVERPEVTETTALGVAYLAGLKLGLYRDLEAIASHWHRQQRFEPRMNDAHRERL
YAGWLDAVKRVRSEP
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaatacctgctagccatcgaccagggcaccaccagctcccgcgccatcatcttc
agtgctcagggcttgccggtggcgcgtgctcagcaggaattcaagcagtacttcccgcag
gatggctgggtcgagcacgacggccaggagatctggctgtccacgctcaaggtctgccgt
gacgccatcgccagcagtggtctgcagcctgaggcgatcgccgccatcggcatcaccaac
cagcgcgaaaccacgctggtctgggatgccaagacaggcacgcccatccacccggccatt
gtctggcaggatcgccgcaccgccgactattgcgccgggctcaaggagcaaggccacgag
gcaatggtctcggccaagaccggcctgctgatcgatccgtatttctccgccaccaagttg
cgctggattctgcgcaacgtgcccggcgcgcaggagcgggcagagcgcggtgagctgcgt
ttcggtacggtcgacagcttcctgctgtggcgcctgaccgatggcaaggtgcaccgcacc
gacgccagcaatgcgtcgcgcacactgatgttcaacatccatacccagcagtgggacgag
gagttgctcgagctgttcggcattcccgccggcctgctacccgaggtgctcgattgcgcc
gccgagttcggtcataccgagcgcgagctgctcggcgccagtatcccggtgttgggtatg
gccggcgaccagcaggcagccttgatcggtcaggcctgcttcgagccgggcatggtcaag
agtacctatggcactggctgcttcatgattcaaaacaccggtgagcaaccggtgacttcg
aagaatcgcctgctgaccacggtgggctaccggctcgatggcaaggtcacctacgcggtg
gagggcagcatcttcgttgccggcgccgccgtgcagtggctgcgcgacggcatcaagctg
atcagtcatgcgcgcgaaagcgaggccctggccgaggcaacaggggaagcctgcggggtg
tttctggtgccggccttcaccggcctgggcgcgccttactgggacccgaaggcacgtggt
gcgatcttcggtctgactcgtgataccgggatcaaggagatcgtcaccgccggcctgcag
tccgtttgctaccagacccgcgacctgctcgaagccatgcgccaggacggtgcggcggcg
cccagcgcgctgcgcgtggacggcggcatggtggagaacaactgggtcatgcagtttctt
gccgacatcctcggcgtcagtgtcgagcggcccgaggtcaccgagaccactgcactcggc
gttgcctatctggcagggctgaaactcgggctgtatcgcgacctcgaggccatcgccagc
cactggcatcgccagcaacgtttcgagccgcggatgaacgacgcgcatcgcgagcgtctc
tacgccggctggctggacgcggtgaagcgggtgcgcagtgagccctga

DBGET integrated database retrieval system