KEGG   Pseudomonas mendocina NK-01: MDS_3716Help
Entry
MDS_3716          CDS       T01473                                 

Definition
protein-disulfide isomerase-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pmk  Pseudomonas mendocina NK-01
Brite
Enzymes [BR:pmk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     MDS_3716
Secretion system [BR:pmk02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   MDS_3716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4095565..4096293)
Genome map
AA seq 242 aa AA seqDB search
MSLTRISIALALALGSSVTLAADPDQVIRQSLKSLDASLPIEAIAESPMTGIYQVQLEGG
RQLYTSADGQFLIQGYLFQVKDGKAVNLTEIEENRAVAKQINAIPAKEMVVFAPKAPKTH
ITVFTDTDCGYCQKLHSEVPELNRLGVEVRYVAFPRQGLNSPAAKELVSVWCAKDQQEAM
NRAKTRQSVADATCDNPVAKQYQLGQMIGVNGTPAIVLANGKMIPGYQPAPQLAKIALES
ND
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtccttgacccgtatttccattgctctggcgcttgcgctgggcagtagcgtcacgctg
gctgccgatcctgatcaggtcatccgtcagtcgctgaagtcgctcgatgccagcctgccc
atcgaggccattgccgagagcccgatgaccggtatctatcaggtgcaactggagggaggg
cgtcagctctacaccagtgccgatggtcagttcctgattcagggctacctgttccaggtc
aaggatggcaaggctgtcaacctgaccgagatcgaagaaaatcgcgcggtggccaagcag
atcaacgccattcctgccaaggaaatggtggtgttcgcgcccaaggcgccgaagacccat
atcaccgtcttcaccgataccgactgtggttattgccagaagctgcacagcgaagtgccc
gagctcaaccgtctgggcgtcgaagtgcgttatgttgcgttcccgcgccaggggttgaac
agcccggcggccaaggagctggtcagcgtctggtgcgccaaggaccagcaggaagcgatg
aatcgcgccaagactcgccagagcgtcgccgacgctacctgtgacaatcctgtagccaag
cagtatcagcttggccagatgatcggcgtcaacggcacgccggccatcgtgctggccaac
ggcaagatgattccgggctaccagccggcgccgcagctcgccaagattgcgctggagtcc
aacgactga

DBGET integrated database retrieval system