KEGG   Pseudomonas mendocina NK-01: MDS_3793Help
Entry
MDS_3793          CDS       T01473                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MDS_3793
   00240 Pyrimidine metabolism
    MDS_3793
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    MDS_3793
   03430 Mismatch repair
    MDS_3793
   03440 Homologous recombination
    MDS_3793
Enzymes [BR:pmk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     MDS_3793
DNA replication proteins [BR:pmk03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     MDS_3793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4168123..4168542
Genome map
AA seq 139 aa AA seqDB search
MPRIEFYVLSSNDAIGRLRAACQLALKAWSAGLPVFVRGSDEAQCAELNELLWTFKAERF
VPHDLHQDAPLSPVVLGIDEAPSADQGVLINLGSSLSPHVERFSRIIEIVNQQPELLSAC
RENFRTYRQRGYDPQRVEL
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcccagaatcgagttctatgttctctcctccaacgacgccattggtcggctgcgtgcc
gcctgccaattggcgctcaaggcctggagcgccggcctgccggtattcgtccggggtagc
gatgaggcgcaatgtgctgagctcaacgagctgctatggaccttcaaggccgaacgcttc
gtgccccacgacctgcatcaggacgccccgctatcacccgtggtgctgggcatcgacgag
gccccgagtgccgatcagggcgtattgatcaacctcggcagcagcctgtcgccgcacgtc
gagcgcttctcccgcatcatcgagatcgtcaaccagcaacccgagttgctgagcgcctgt
cgcgagaatttccgcacctaccgccagcgcgggtatgatccgcagcgcgtcgaactttag

DBGET integrated database retrieval system