KEGG   Pseudomonas mendocina NK-01: MDS_3895Help
Entry
MDS_3895          CDS       T01473                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MDS_3895
Enzymes [BR:pmk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     MDS_3895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4288401..4288889
Genome map
AA seq 162 aa AA seqDB search
MMERVYIGLGSNLAEPLQQLRAALNAIAQLPHSRLQAQSSFYISDPLGPADQPRYVNAVA
ALDTELEPWQLLDALQRIEQEQGRVRKAERWGPRTLDLDILLFGDRLLDDERLTVPHYHM
HARPFVLYPLAELVTELQLPDGRSLSALLDACPFSGLERLPQ
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgatggagcgggtctacatcggtctcggcagcaatcttgccgagcccctgcagcagttg
cgcgcagccttgaacgccatcgcccagttaccgcacagccgcttgcaggcgcagtcgtcg
ttctacatcagcgacccgctcggcccggcagaccagccacgctacgttaacgcagtggcg
gcgctggataccgagctggagccctggcagctgctggacgcactgcaacgcatcgagcag
gagcagggccgcgtgcgcaaggccgagcgttggggcccgcgcaccctggatctggatatc
ctgctgttcggtgatcgcctgctcgacgacgagcgcctgacggtaccgcactaccacatg
catgcccgccccttcgtgctctacccgttggccgagctggtcacggagctgcagttgccg
gacggtcgcagcctgagcgccctgctggacgcctgccccttcagcgggctagaacgcctg
ccgcagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system