KEGG   Pseudomonas mendocina NK-01: MDS_3901Help
Entry
MDS_3901          CDS       T01473                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MDS_3901
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MDS_3901
   00620 Pyruvate metabolism
    MDS_3901
   00640 Propanoate metabolism
    MDS_3901
  Energy metabolism
   00680 Methane metabolism
    MDS_3901
Enzymes [BR:pmk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MDS_3901
Lipid biosynthesis proteins [BR:pmk01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MDS_3901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4294823..4296760
Genome map
AA seq 645 aa AA seqDB search
MFEITRHPVQDAVRQRAHLDNDAYLRLYQQSVEQPDTFWAEQAKAFLDWFKPWDQVHASD
LKQGRAEWFKGGQLNVAYNCIDRHLEKRGEQIAIIWEGDNPAESAHITYNKLHHNVSRLA
NVLKRRGVKKGDRVCIYMPMIPEAAYAMLACARIGAVHSVVFGGFSPDALRDRILDADCR
AVITADEGVRGGKYVPLKANVDKALQSCPDVSTVVVVERTQGNVAWVEGRDLWYHQALKE
VDADCPAEPMDAEDPLFILYTSGSTGKPKGVLHTTGGYLLGAAMTHKYVFDYHEGDIYWC
TADVGWVTGHSYIVYGPLANAATTLMFEGVPNYPDASRFWQVIDKHQVNTFYTAPTALRA
LMREGEVPVKATSRSSLRLLGTVGEPINPEAWEWYFHVVGDTRCPIVDTWWQTETGSILI
TPLPGATDLKPGSATRPFFGVQPVLLDEQGKEIDGPGSGVLAIKASWPSQIRSVYGDHQR
MVDTYFKPYPGYYFTGDGARRDEDGYYWITGRVDDVINVSGHRIGTAEVESALVLHDAVA
EAAVVGYPHDVKGQGIYAYVTLMNGQEPSDELKKDLLTLVGKEIGSFAKPELIQWAPGLP
KTRSGKIMRRILRKIACNELENMGDTSTLADPSVVDSLTEQRLNR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagatcacccgccatcccgtgcaagatgccgtgcgtcagcgcgcgcatcttgat
aacgacgcctacctgcgtctgtaccagcagtccgtcgagcagcccgatactttctgggct
gagcaggccaaggccttcctcgactggttcaaaccctgggatcaggtgcacgctagcgac
ctcaagcagggccgcgccgagtggttcaagggcggccaactcaacgtcgcctacaactgc
atcgatcgccacctggaaaaacgcggcgaacagatcgccatcatctgggaaggcgacaat
ccggccgaatcggcgcacatcacctacaacaagctgcaccacaacgtcagccgcctggcc
aacgtgctcaagcgccgtggggtgaagaaaggcgaccgggtctgcatctacatgccgatg
attcccgaggcggcctacgccatgctcgcctgcgcgcgcatcggcgccgtgcattcggtg
gtattcggcggcttctccccggacgccctgcgtgaccgcatcctcgatgccgactgccgc
gccgtgatcaccgccgatgaaggcgtacgcggtggcaagtacgtgccgctgaaagccaac
gtcgacaaagccttgcagagctgcccagacgtatccaccgtggtggtggtcgagcgcacc
caaggcaatgtcgcctgggtcgaaggccgcgacctctggtaccaccaggcgctcaaggaa
gtcgacgccgattgcccggccgagccgatggacgccgaggacccgctgttcatcctctac
acctccggcagcaccggcaaacccaagggcgtgctgcacaccaccggcggctacctgctc
ggcgcggcgatgacccacaagtacgtgttcgactaccacgagggcgacatctactggtgc
accgccgatgtcggctgggtcaccgggcacagctacatcgtctacggcccgctggccaat
gccgccaccacactgatgttcgagggcgtaccgaactacccggacgcctcgcgcttctgg
caggtgatcgacaagcaccaggtcaacaccttctacaccgcaccaaccgccctgcgcgca
ctgatgcgcgaaggcgaagtcccggtcaaggccacctcgcgctcgagcctgcgcctgctc
ggcaccgtgggtgagccgatcaacccggaagcctgggaatggtatttccacgtagtcggc
gacacgcgctgccccatcgtcgacacctggtggcagaccgagaccggctccattctgatc
actccactgcccggagccactgacctgaagcccggctcggccacccgccccttcttcggc
gtgcaaccggtgctactggatgaacagggcaaggaaatcgatggccccggcagcggcgtg
ctggcgatcaaggcgagttggccgagccagatccgcagcgtctacggcgaccatcagcgc
atggtcgacacctacttcaaaccctaccccggctactacttcaccggcgacggtgcacgc
cgcgacgaggacggctactactggatcaccggacgggtggacgacgtgatcaacgtctcc
ggccaccgcatcggcaccgccgaggtggaaagcgccctggtgctgcacgatgccgtggcc
gaagccgccgtggtcggctacccgcatgacgtgaaaggccagggcatctacgcctacgtc
accctgatgaacggccaggagccctccgacgagctgaagaaggacctgctgaccctggtc
ggcaaggaaatcggcagtttcgccaagccggagctgatccagtgggcgccaggtctgccc
aagacccgctcgggcaagatcatgcgccgcatcctgcgcaagatcgcctgcaacgagctg
gagaacatgggcgatacctcgacccttgccgacccaagcgtggtcgacagcctgaccgag
cagcgcctgaaccgctaa

DBGET integrated database retrieval system