KEGG   Pseudomonas mendocina NK-01: MDS_3901Help
Entry
MDS_3901          CDS       T01473                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pmk01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pmk00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pmk00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pmk00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:pmk00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4294823..4296760
Genome map
AA seq 645 aa AA seqDB search
MFEITRHPVQDAVRQRAHLDNDAYLRLYQQSVEQPDTFWAEQAKAFLDWFKPWDQVHASD
LKQGRAEWFKGGQLNVAYNCIDRHLEKRGEQIAIIWEGDNPAESAHITYNKLHHNVSRLA
NVLKRRGVKKGDRVCIYMPMIPEAAYAMLACARIGAVHSVVFGGFSPDALRDRILDADCR
AVITADEGVRGGKYVPLKANVDKALQSCPDVSTVVVVERTQGNVAWVEGRDLWYHQALKE
VDADCPAEPMDAEDPLFILYTSGSTGKPKGVLHTTGGYLLGAAMTHKYVFDYHEGDIYWC
TADVGWVTGHSYIVYGPLANAATTLMFEGVPNYPDASRFWQVIDKHQVNTFYTAPTALRA
LMREGEVPVKATSRSSLRLLGTVGEPINPEAWEWYFHVVGDTRCPIVDTWWQTETGSILI
TPLPGATDLKPGSATRPFFGVQPVLLDEQGKEIDGPGSGVLAIKASWPSQIRSVYGDHQR
MVDTYFKPYPGYYFTGDGARRDEDGYYWITGRVDDVINVSGHRIGTAEVESALVLHDAVA
EAAVVGYPHDVKGQGIYAYVTLMNGQEPSDELKKDLLTLVGKEIGSFAKPELIQWAPGLP
KTRSGKIMRRILRKIACNELENMGDTSTLADPSVVDSLTEQRLNR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagatcacccgccatcccgtgcaagatgccgtgcgtcagcgcgcgcatcttgat
aacgacgcctacctgcgtctgtaccagcagtccgtcgagcagcccgatactttctgggct
gagcaggccaaggccttcctcgactggttcaaaccctgggatcaggtgcacgctagcgac
ctcaagcagggccgcgccgagtggttcaagggcggccaactcaacgtcgcctacaactgc
atcgatcgccacctggaaaaacgcggcgaacagatcgccatcatctgggaaggcgacaat
ccggccgaatcggcgcacatcacctacaacaagctgcaccacaacgtcagccgcctggcc
aacgtgctcaagcgccgtggggtgaagaaaggcgaccgggtctgcatctacatgccgatg
attcccgaggcggcctacgccatgctcgcctgcgcgcgcatcggcgccgtgcattcggtg
gtattcggcggcttctccccggacgccctgcgtgaccgcatcctcgatgccgactgccgc
gccgtgatcaccgccgatgaaggcgtacgcggtggcaagtacgtgccgctgaaagccaac
gtcgacaaagccttgcagagctgcccagacgtatccaccgtggtggtggtcgagcgcacc
caaggcaatgtcgcctgggtcgaaggccgcgacctctggtaccaccaggcgctcaaggaa
gtcgacgccgattgcccggccgagccgatggacgccgaggacccgctgttcatcctctac
acctccggcagcaccggcaaacccaagggcgtgctgcacaccaccggcggctacctgctc
ggcgcggcgatgacccacaagtacgtgttcgactaccacgagggcgacatctactggtgc
accgccgatgtcggctgggtcaccgggcacagctacatcgtctacggcccgctggccaat
gccgccaccacactgatgttcgagggcgtaccgaactacccggacgcctcgcgcttctgg
caggtgatcgacaagcaccaggtcaacaccttctacaccgcaccaaccgccctgcgcgca
ctgatgcgcgaaggcgaagtcccggtcaaggccacctcgcgctcgagcctgcgcctgctc
ggcaccgtgggtgagccgatcaacccggaagcctgggaatggtatttccacgtagtcggc
gacacgcgctgccccatcgtcgacacctggtggcagaccgagaccggctccattctgatc
actccactgcccggagccactgacctgaagcccggctcggccacccgccccttcttcggc
gtgcaaccggtgctactggatgaacagggcaaggaaatcgatggccccggcagcggcgtg
ctggcgatcaaggcgagttggccgagccagatccgcagcgtctacggcgaccatcagcgc
atggtcgacacctacttcaaaccctaccccggctactacttcaccggcgacggtgcacgc
cgcgacgaggacggctactactggatcaccggacgggtggacgacgtgatcaacgtctcc
ggccaccgcatcggcaccgccgaggtggaaagcgccctggtgctgcacgatgccgtggcc
gaagccgccgtggtcggctacccgcatgacgtgaaaggccagggcatctacgcctacgtc
accctgatgaacggccaggagccctccgacgagctgaagaaggacctgctgaccctggtc
ggcaaggaaatcggcagtttcgccaagccggagctgatccagtgggcgccaggtctgccc
aagacccgctcgggcaagatcatgcgccgcatcctgcgcaagatcgcctgcaacgagctg
gagaacatgggcgatacctcgacccttgccgacccaagcgtggtcgacagcctgaccgag
cagcgcctgaaccgctaa

DBGET integrated database retrieval system