KEGG   Pseudomonas mendocina NK-01: MDS_3901Help
Entry
MDS_3901          CDS       T01473                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk00010  Glycolysis / Gluconeogenesis
pmk00620  Pyruvate metabolism
pmk00640  Propanoate metabolism
pmk00680  Methane metabolism
pmk01100  Metabolic pathways
pmk01110  Biosynthesis of secondary metabolites
pmk01120  Microbial metabolism in diverse environments
pmk01130  Biosynthesis of antibiotics
pmk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MDS_3901
   00620 Pyruvate metabolism
    MDS_3901
   00640 Propanoate metabolism
    MDS_3901
  Energy metabolism
   00680 Methane metabolism
    MDS_3901
Enzymes [BR:pmk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MDS_3901
Lipid biosynthesis proteins [BR:pmk01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MDS_3901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEB59932
UniProt: F4DVU2
Position
4294823..4296760
Genome map
AA seq 645 aa AA seqDB search
MFEITRHPVQDAVRQRAHLDNDAYLRLYQQSVEQPDTFWAEQAKAFLDWFKPWDQVHASD
LKQGRAEWFKGGQLNVAYNCIDRHLEKRGEQIAIIWEGDNPAESAHITYNKLHHNVSRLA
NVLKRRGVKKGDRVCIYMPMIPEAAYAMLACARIGAVHSVVFGGFSPDALRDRILDADCR
AVITADEGVRGGKYVPLKANVDKALQSCPDVSTVVVVERTQGNVAWVEGRDLWYHQALKE
VDADCPAEPMDAEDPLFILYTSGSTGKPKGVLHTTGGYLLGAAMTHKYVFDYHEGDIYWC
TADVGWVTGHSYIVYGPLANAATTLMFEGVPNYPDASRFWQVIDKHQVNTFYTAPTALRA
LMREGEVPVKATSRSSLRLLGTVGEPINPEAWEWYFHVVGDTRCPIVDTWWQTETGSILI
TPLPGATDLKPGSATRPFFGVQPVLLDEQGKEIDGPGSGVLAIKASWPSQIRSVYGDHQR
MVDTYFKPYPGYYFTGDGARRDEDGYYWITGRVDDVINVSGHRIGTAEVESALVLHDAVA
EAAVVGYPHDVKGQGIYAYVTLMNGQEPSDELKKDLLTLVGKEIGSFAKPELIQWAPGLP
KTRSGKIMRRILRKIACNELENMGDTSTLADPSVVDSLTEQRLNR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagatcacccgccatcccgtgcaagatgccgtgcgtcagcgcgcgcatcttgat
aacgacgcctacctgcgtctgtaccagcagtccgtcgagcagcccgatactttctgggct
gagcaggccaaggccttcctcgactggttcaaaccctgggatcaggtgcacgctagcgac
ctcaagcagggccgcgccgagtggttcaagggcggccaactcaacgtcgcctacaactgc
atcgatcgccacctggaaaaacgcggcgaacagatcgccatcatctgggaaggcgacaat
ccggccgaatcggcgcacatcacctacaacaagctgcaccacaacgtcagccgcctggcc
aacgtgctcaagcgccgtggggtgaagaaaggcgaccgggtctgcatctacatgccgatg
attcccgaggcggcctacgccatgctcgcctgcgcgcgcatcggcgccgtgcattcggtg
gtattcggcggcttctccccggacgccctgcgtgaccgcatcctcgatgccgactgccgc
gccgtgatcaccgccgatgaaggcgtacgcggtggcaagtacgtgccgctgaaagccaac
gtcgacaaagccttgcagagctgcccagacgtatccaccgtggtggtggtcgagcgcacc
caaggcaatgtcgcctgggtcgaaggccgcgacctctggtaccaccaggcgctcaaggaa
gtcgacgccgattgcccggccgagccgatggacgccgaggacccgctgttcatcctctac
acctccggcagcaccggcaaacccaagggcgtgctgcacaccaccggcggctacctgctc
ggcgcggcgatgacccacaagtacgtgttcgactaccacgagggcgacatctactggtgc
accgccgatgtcggctgggtcaccgggcacagctacatcgtctacggcccgctggccaat
gccgccaccacactgatgttcgagggcgtaccgaactacccggacgcctcgcgcttctgg
caggtgatcgacaagcaccaggtcaacaccttctacaccgcaccaaccgccctgcgcgca
ctgatgcgcgaaggcgaagtcccggtcaaggccacctcgcgctcgagcctgcgcctgctc
ggcaccgtgggtgagccgatcaacccggaagcctgggaatggtatttccacgtagtcggc
gacacgcgctgccccatcgtcgacacctggtggcagaccgagaccggctccattctgatc
actccactgcccggagccactgacctgaagcccggctcggccacccgccccttcttcggc
gtgcaaccggtgctactggatgaacagggcaaggaaatcgatggccccggcagcggcgtg
ctggcgatcaaggcgagttggccgagccagatccgcagcgtctacggcgaccatcagcgc
atggtcgacacctacttcaaaccctaccccggctactacttcaccggcgacggtgcacgc
cgcgacgaggacggctactactggatcaccggacgggtggacgacgtgatcaacgtctcc
ggccaccgcatcggcaccgccgaggtggaaagcgccctggtgctgcacgatgccgtggcc
gaagccgccgtggtcggctacccgcatgacgtgaaaggccagggcatctacgcctacgtc
accctgatgaacggccaggagccctccgacgagctgaagaaggacctgctgaccctggtc
ggcaaggaaatcggcagtttcgccaagccggagctgatccagtgggcgccaggtctgccc
aagacccgctcgggcaagatcatgcgccgcatcctgcgcaagatcgcctgcaacgagctg
gagaacatgggcgatacctcgacccttgccgacccaagcgtggtcgacagcctgaccgag
cagcgcctgaaccgctaa

DBGET integrated database retrieval system