KEGG   Pseudomonas mendocina NK-01: MDS_3917Help
Entry
MDS_3917          CDS       T01473                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk00010  Glycolysis / Gluconeogenesis
pmk00051  Fructose and mannose metabolism
pmk00562  Inositol phosphate metabolism
pmk01100  Metabolic pathways
pmk01110  Biosynthesis of secondary metabolites
pmk01120  Microbial metabolism in diverse environments
pmk01130  Biosynthesis of antibiotics
pmk01200  Carbon metabolism
pmk01230  Biosynthesis of amino acids
Module
pmk_M00002  Glycolysis, core module involving three-carbon compounds
pmk_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MDS_3917
   00051 Fructose and mannose metabolism
    MDS_3917
   00562 Inositol phosphate metabolism
    MDS_3917
Enzymes [BR:pmk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MDS_3917
Exosome [BR:pmk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MDS_3917
  Exosomal proteins of bladder cancer cells
   MDS_3917
  Exosomal proteins of melanoma cells
   MDS_3917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEB59948
UniProt: F4DVV8
Position
complement(4313180..4313935)
Genome map
AA seq 251 aa AA seqDB search
MRRPLVAGNWKMHGTRASVAELIEGLRQQDLPADVEVAVFPSSLHIAQVVEGLDGKAVKV
GAQDCAAQVEQGALTGELAVSQLVDGGCGLVLVGHSERRLILGESDEVIVRKFAAIQAAG
LVPVLCVGETREQREASETLGVVGGQLAAVVDALGVEALKNAVVAYEPVWAIGTGLTATP
EQAQEVHAAIRAQVAQLNAEVASELRILYGGSVKAASAVELFGMQDIDGGLVGGASLNAD
EFGAICRAAGN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgccccttggtcgccggtaactggaaaatgcacggtacccgcgccagcgtcgca
gagctgatcgaagggttgcgtcagcaggacttgcctgccgatgtcgaggtcgcggtgttc
ccctccagtctgcatatcgctcaggtcgtcgaaggcctggatggcaaggctgtgaaggtt
ggagcgcaggattgcgcggcgcaagtcgagcagggcgccttgaccggtgagcttgcagtc
agtcagttggtcgatggcggctgtgggttggtgctggttggtcattccgagcgtcgcctg
attctgggtgagagtgacgaagtgatcgtgcgcaagtttgctgcaattcaggctgccggc
ctggtgccggtgctctgtgtcggtgagacgcgtgagcagcgcgaagcgagtgaaacgctg
ggtgtggtgggcggccaattggctgcagtggtcgatgccctgggtgtcgaagcgctaaag
aatgccgtagttgcctatgagcctgtctgggccattggtacagggttgaccgctacgcct
gagcaggctcaggaggtgcatgcagcgattcgcgcgcaggttgcgcagttgaatgctgaa
gttgccagtgagctgagaattctttatggcggcagtgtgaaggccgccagtgcagtcgag
ttattcggcatgcaggatatcgatggggggctcgtgggtggagcctctctgaatgcggat
gaattcggtgcgatttgtcgcgctgcaggaaactga

DBGET integrated database retrieval system