KEGG   Pseudomonas mendocina NK-01: MDS_3917Help
Entry
MDS_3917          CDS       T01473                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MDS_3917
   01230 Biosynthesis of amino acids
    MDS_3917
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MDS_3917
   00051 Fructose and mannose metabolism
    MDS_3917
   00562 Inositol phosphate metabolism
    MDS_3917
Enzymes [BR:pmk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MDS_3917
Exosome [BR:pmk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MDS_3917
  Exosomal proteins of bladder cancer cells
   MDS_3917
  Exosomal proteins of melanoma cells
   MDS_3917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4313180..4313935)
Genome map
AA seq 251 aa AA seqDB search
MRRPLVAGNWKMHGTRASVAELIEGLRQQDLPADVEVAVFPSSLHIAQVVEGLDGKAVKV
GAQDCAAQVEQGALTGELAVSQLVDGGCGLVLVGHSERRLILGESDEVIVRKFAAIQAAG
LVPVLCVGETREQREASETLGVVGGQLAAVVDALGVEALKNAVVAYEPVWAIGTGLTATP
EQAQEVHAAIRAQVAQLNAEVASELRILYGGSVKAASAVELFGMQDIDGGLVGGASLNAD
EFGAICRAAGN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgccccttggtcgccggtaactggaaaatgcacggtacccgcgccagcgtcgca
gagctgatcgaagggttgcgtcagcaggacttgcctgccgatgtcgaggtcgcggtgttc
ccctccagtctgcatatcgctcaggtcgtcgaaggcctggatggcaaggctgtgaaggtt
ggagcgcaggattgcgcggcgcaagtcgagcagggcgccttgaccggtgagcttgcagtc
agtcagttggtcgatggcggctgtgggttggtgctggttggtcattccgagcgtcgcctg
attctgggtgagagtgacgaagtgatcgtgcgcaagtttgctgcaattcaggctgccggc
ctggtgccggtgctctgtgtcggtgagacgcgtgagcagcgcgaagcgagtgaaacgctg
ggtgtggtgggcggccaattggctgcagtggtcgatgccctgggtgtcgaagcgctaaag
aatgccgtagttgcctatgagcctgtctgggccattggtacagggttgaccgctacgcct
gagcaggctcaggaggtgcatgcagcgattcgcgcgcaggttgcgcagttgaatgctgaa
gttgccagtgagctgagaattctttatggcggcagtgtgaaggccgccagtgcagtcgag
ttattcggcatgcaggatatcgatggggggctcgtgggtggagcctctctgaatgcggat
gaattcggtgcgatttgtcgcgctgcaggaaactga

DBGET integrated database retrieval system