KEGG   Pseudomonas mendocina NK-01: MDS_3944Help
Entry
MDS_3944          CDS       T01473                                 

Definition
peroxiredoxin
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pmk00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pmk00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4344933..4345418)
Genome map
AA seq 161 aa AA seqDB search
MSAFHDLNLRALDGQELPLAPYKGQVVLVVNVASKCGLTPQYAGLEKLYQQYKGNGFTVL
GVPCNQFAGQEPGSEDEIRSFCSLNYGVTFPLGSKLEVNGPGRHPLYRLLAGEGAEFPGD
ITWNFEKFLVGQDGRVLARFSPRTTPDDPALIQAIEKALGL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcctttcacgatctcaatctacgtgcgctggatggccaggaactgccgctggcg
ccttacaagggccaagtggtgctggtggtcaatgtcgcttccaagtgcggtttgacgcct
cagtacgcggggctggaaaagctctaccagcagtacaagggcaacggcttcacggtactg
ggagtgccatgcaaccagttcgccggacaggagccgggcagcgaggacgagatccgttcg
ttctgtagcctcaactatggcgtgaccttcccgctgggtagcaagctggaggtcaacggt
cctggtcggcacccgctgtatcgcctgctggcgggcgagggcgcggagtttcctggggac
atcacctggaacttcgagaagtttctggtcggccaggacggccgcgtgctggcgcgcttc
tcgccgcgcaccacgccggatgaccctgcactgatccaggccatcgaaaaggcgctcggc
ctctag

DBGET integrated database retrieval system