KEGG   Pseudomonas mendocina NK-01: MDS_4068Help
Entry
MDS_4068          CDS       T01473                                 

Definition
AMP nucleosidase
Orthology
K01241  
AMP nucleosidase [EC:3.2.2.4]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Purine metabolism
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pmk00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4472925..4474397)
Genome map
AA seq 490 aa AA seqDB search
MKACSDDFIIAHTPEEAVDRLAALHQEATGALSHALKRYLKERIRPDASEHCLFRYPELR
LTYLCQGEVPTTVRAYAKVQVPGTYAITVTQPAAFRKYLLEQLRPLMNDFTLRVEVGRSQ
QNIPYPYVVEGGDELAGSGVTAAELARVFPSTDLSAATDGTADGLYDWENIDPLPLALFD
AARTDFSLKRIQHYTGSDWRHVQPWILLTNYHRYVDQFIRHGLDMLVGNSRFTRMVLPGN
VVVERGMAEGEMQAIIENVVWHRYQMPAYHLQAEDGHGITLVNIGVGPSNAKNITDHLAV
LRPHCWLMIGHCGGLRQSQTIGDYVLAHAYMRRDGILDRVLPPNIPLPALAEVQQALQEA
AKLVTGEEGDELKKRLRTGTVLTYDDRNWELRWAQERPLINLSRAVAVDMESGTIAAQGY
RLRVPYGTLLCVSDKPLHSEIKLPGAAGAFYERAVTQHLHIGIAALELMRSQLNSLHSRK
LRSFDEPPFR
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcctgctcagatgatttcatcattgcccacactcccgaagaggcggtcgaccgc
cttgccgctttgcaccaggaagccaccggcgccctgagccacgcgctcaagcgctacctc
aaggagcgcatccgcccggatgccagcgagcactgcctgttccgctatcccgaactgcgc
ctgacctacctgtgccagggcgaggtgccgaccaccgtgcgtgcctatgccaaggtgcag
gtgccgggcacctacgccatcaccgtgacccagccggcagccttccgcaaatacctgctg
gaacagctgcgcccgctgatgaacgacttcaccctgcgtgtggaagtcggccgcagccag
cagaacattccctacccgtacgtggttgaaggtggtgacgagctggccggcagcggtgtg
accgccgccgagctggcgcgggtatttcccagtaccgacctgtccgctgctaccgacggc
accgccgatggcctctacgactgggagaacatcgacccgctgccgctggcgctgttcgat
gcggcacgcacggacttctcgctcaagcgcatccagcactacaccggcagtgactggcgc
catgtgcagccatggatcctgctgaccaactaccaccgctacgtcgaccagttcatccgc
catgggctggacatgctggtgggcaactcgcgcttcacccgcatggtgctgccgggcaat
gtggtggtcgaacgtggcatggccgaaggcgagatgcaggcgatcatcgagaatgtggtc
tggcaccgttaccagatgccggcctaccacctgcaggccgaggacggccacggtattacc
ctggtcaatatcggcgtcggcccgtcgaatgccaagaacatcaccgaccacctcgccgtg
ctgcgcccgcactgctggctgatgatcggccactgcggcggcctgcgtcagtcgcagacc
attggcgactacgtgctggcccacgcctacatgcgccgcgacggcattctcgaccgcgtg
ctgccgccgaacattcctctgccggcgctggccgaagtacagcaggcgctgcaggaagcc
gccaagctggtcactggcgaagagggcgacgaactgaagaagcgcctgcgtaccggcacc
gtactgacctatgacgaccgtaactgggaactgcgctgggctcaggagcgcccgctgatc
aacctgtcgcgcgcggtggcggtggacatggagagcggcaccatcgccgcgcaaggctat
cgcctacgggtgccctacggcacgctgctgtgcgtatcggacaaaccattgcacagcgag
atcaagctgcccggtgcggctggtgccttctacgagcgcgcggtgacccagcacctgcat
atcggcatcgccgcgctggagctgatgcgtagccagctcaactcgctgcattcgcgcaag
ttgcgcagcttcgacgagccgccgttccgctga

DBGET integrated database retrieval system