KEGG   Pseudomonas mendocina NK-01: MDS_4140Help
Entry
MDS_4140          CDS       T01473                                 

Definition
chemotaxis-specific methylesterase
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MDS_4140
Enzymes [BR:pmk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     MDS_4140
Two-component system [BR:pmk02022]
 CheA family
  WspE-WspRF [MD:M00509]
   MDS_4140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4545902..4546906
Genome map
AA seq 334 aa AA seqDB search
MRIAIANDMPLAVEALRRALAAEPEYQLIWVASNGEEAVSRCREDRPELLLMDMLMPGMD
GVEATRQIMNDTPCAILIVTSDVERNMSRVFDAMGAGALDVVAAPSLGPQQVLDAAAVRR
KIHNIAWMIGHKTSRSVKPTPVRSADNRGKRLVAIGASAGGPASLVELLRQIPADFPASI
VLVQHVDEVFAAGMAQWLGSESNIPVRLAREGEVLQPASVLLAGTNNHLYLAPEGRLVYR
REPVDQVYRPSIDVFFESVATHWRGEAIGVLLTGMGRDGARGLKLMRERGFHTIAQDQAS
SAVYGMPKAAVALDAATEVLPLDRIPTRLIERLG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcgccattgccaacgacatgcccctggcggtcgaagccctgcgccgcgcgctg
gcggccgaacccgaatatcagttgatctgggtcgccagcaatggagaggaagcggtcagt
cgctgccgcgaggacaggcccgaactgctgttgatggacatgctcatgcccggcatggat
ggcgtcgaagcgacgcggcagatcatgaatgacacgccctgcgccattctcatcgtcacc
tcggatgtcgagcgcaacatgtcgcgagtgttcgacgccatgggtgccggcgcgctggat
gtggttgccgcaccgtcgctcggcccgcagcaggtgctggatgccgccgcagtgaggcgc
aagattcacaacatcgcctggatgatcggccacaagacctcacgctccgtcaaaccgacg
ccggtgcgcagcgccgacaatcgcggcaaacgtctggtggccatcggtgcctcggccggc
ggcccagcttcgctggtggagctgctgcggcaaataccggccgactttcccgccagcatc
gtgctggtccagcatgtcgatgaagtatttgccgccggcatggcgcagtggctcggcagc
gaatcgaacattcccgtacgcctggcgcgcgaaggcgaagtgctgcaaccggccagcgtg
ctgctggccggtaccaacaaccatctgtatctcgcgccggaaggacgcctggtataccgg
cgcgagccggtcgaccaggtctaccgtccgtccatcgatgtattcttcgagagcgtggcc
acccactggcgaggggaagcgatcggtgtgctgctgaccggcatgggccgcgacggcgcc
agaggcctgaagctgatgcgcgagcgcggctttcacaccatcgcccaggaccaggccagt
agcgccgtctacggcatgcccaaggccgcagtggcattggacgccgcgacggaggtgctg
cccctggacaggattccgacgcgcctgatcgagcgcctcggctga

DBGET integrated database retrieval system