KEGG   Pseudomonas mendocina NK-01: MDS_4311Help
Entry
MDS_4311          CDS       T01473                                 

Definition
tyrosyl-tRNA synthetase
Orthology
K01866  
tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    MDS_4311
Enzymes [BR:pmk01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     MDS_4311
Amino acid related enzymes [BR:pmk01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   MDS_4311
Transfer RNA biogenesis [BR:pmk03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    MDS_4311
 Prokaryotic Type
    MDS_4311
Mitochondrial biogenesis [BR:pmk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    MDS_4311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4720427..4721626)
Genome map
AA seq 399 aa AA seqDB search
MKSVEEQLALIKRGAEEVLVEAELVEKLKRGQPLRIKAGFDPTAPDLHLGHTVLINKLRQ
FQELGHQVVFLIGDFTGMIGDPSGKSATRPPLTREQVLDNAETYKQQVFKILDPAKTEVA
FNSTWMDQLKPADFIRLASQYTVARMLERDDFDKRYTGNQPIAIHEFLYPLVQGYDSVAL
KADVELGGTDQKFNLLMGRELQRAYGQESQCIVTMPLLEGLDGVKKMSKSLGNYVGIQEA
PGVMYNKLVSMPDVLMWRYFELLSFRSMEEIEQFKRDVEQGANPRDIKIKLAEELVARFH
GEEAAASAHRSAGNRMKDGELPADLPEVELVSVEDMPISSVLNKAGLVKNAAVARDLLGS
GGVRVDGEVVDRAFLFKLGSTHVCQAGKKAFARITLKAE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcggttgaagagcagctggcgctgatcaagcgcggtgcggaagaggttctggtt
gaggctgagctggtcgaaaagctcaagcgcggtcagccgctgcggatcaaggcgggtttc
gaccctactgcgccagatctgcatctcggccataccgttcttattaataagctgcgtcag
ttccaggaactcggccatcaggtggtcttcctgattggggatttcaccgggatgatcggt
gaccccagcggcaagagcgcgactcgtccgccgctgacccgtgagcaggttctggataat
gccgagacctataagcagcaggtgttcaagattctcgatccggccaagaccgaggtcgcc
ttcaactcgacctggatggaccagctcaagcctgctgacttcattcgcctggcttcgcag
tacaccgtggcgcggatgctcgagcgcgacgacttcgacaagcgctataccggtaatcag
ccgatcgcgattcatgagttcctttacccgttggtgcagggctatgactccgtggcgctc
aaggctgatgtcgagctggggggtaccgatcagaagttcaatctgctgatggggcgcgag
ctgcagcgcgcttatgggcaggagtcgcagtgcatcgtcaccatgccgttgttggaaggt
ctcgatggcgtgaagaagatgtccaaatccttgggtaactacgtcggtatccaggaagcg
ccgggtgtgatgtacaacaaactggtgtccatgcctgatgtgctgatgtggcgctatttc
gagctgctcagcttccggtccatggaggagatcgagcagttcaagcgtgatgtcgagcag
ggggcgaatccgcgtgacatcaagatcaaactggccgaggagctcgttgcgcgttttcat
ggcgaggaggcggctgccagtgcccatcgttccgcaggcaaccgtatgaaggatggcgag
ttgccggcagatctgccagaagtcgagctggtttcggttgaagatatgccgatctcgtcc
gtccttaataaagcaggcctggttaagaatgctgccgtggctcgtgacctgctgggctct
ggtggtgtgcgcgtcgatggtgaagtggtcgaccgtgctttcctgttcaagctgggttct
acccatgtctgccaggctggcaagaaggcctttgcgcgtatcaccctcaaggccgagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system