KEGG   Pseudomonas mendocina NK-01: MDS_4709Help
Entry
MDS_4709          CDS       T01473                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pmk00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pmk00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pmk00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pmk00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pmk00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pmk00520]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pmk00230]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:pmk00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5157862..5160450
Genome map
AA seq 862 aa AA seqDB search
MKLFKRTAKEVDSAASLVPDQPKRKATNPSLGTLLPGLLAALIGVGAGGALLWFADSSSS
QARQAELTQALGSNQAAAVQQALKQLQADSLAAARNPQLLQALQSGDSLQVSEAERSLGY
WDGVIDAHLNRRGEAVQNTSRAAPMNFAGLDMLRRAESGQQPAVEAYRVGQRWLAYSAVA
LRVGENQPAQGTLLLAFDLQRLLATLPALPAEYGQVQLIQQFANTPAQVLVQRGQPGEGS
AQTFSTGNPYWKISFIPGPALMQSSVPASMLGLALLLALGGAVIGLILVQGALQRRVNLD
AGQLGQMLKELSAGKNVKAFSLSVPALDTLAQSLARLPRRSSPEGSSTPVKGTAAAPATQ
PAAKPAELVDPLFQDTDILDIDILDEDQDLLGLEQSPAMSTSQSAPKLPADIFRAYDIRG
VVGDTLTAEYAYWIGRAIGSKSLAQGEPKVIVGRDGRLSGPELLQQLVQGLLDCGCEVTD
IGMVPTPVVYFAANVLEGRSAVMLTGSHNPPDYNGFKIIIAGDTLANEQILALKTRLDNN
DLASGVGSVQQVDVLQRYFKTIRDDIALAKPLRVVVDCGNGAAGVIAPQLIEALGCSVIP
LFCEVDGTFPNHHPDPGKPENLVDLIARVKSENADLGLAFDGDGDRVGVVTNTGTIVYPD
RLLMLFAKDVVSRNPGADIIFDVKCTRRLTPLISGYGGRPVMWKTGHSLIKKKMKETGAL
LAGEMSGHIFFKERWYGFDDGIYSAARLLEILSLEKRNAEQVFSAFPSDISTPEINIKVT
EQTKFGMIERLQREGQWGEANITSIDGVRVDYPKGWGLIRASNTTPVLVLRFEADTQEEL
ERIQDVFRTQLLKVAPDLQLPF
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactcttcaagcgtactgccaaggaagtcgatagcgccgccagcctggtaccggac
cagcccaagcgcaaggcgaccaatccctcgctggggacgctgttgccaggcctgctggcc
gccctgatcggcgtcggcgccggcggtgcgttgctgtggttcgccgatagcagcagcagc
caggctcgccaggccgagttgacccaggccctcggcagcaaccaggctgccgctgtacaa
caggcgctcaagcaactgcaagccgacagcctggccgctgcgcgtaacccgcagctgctg
caagcactgcaaagcggcgacagcctgcaggtcagcgaagccgaacgcagcctgggttac
tgggacggtgtgatcgacgcccatctcaaccgccgcggtgaagccgtgcagaacaccagc
cgcgccgcgccgatgaacttcgccggcctggacatgctgcgccgcgccgaaagcggccag
cagcccgccgtcgaagcctaccgggtcggtcagcgctggctggcctacagcgccgtggcc
ctgcgcgttggcgagaaccagccggctcagggcacgctgttgctggccttcgacctgcaa
cgcctgctcgccaccctgcctgcgctgcctgccgaatacggccaggtgcagctgatccag
cagttcgccaacaccccggcgcaggtgctggtgcaacgtggccagcccggcgagggcagc
gcacaaaccttttccaccggcaatccgtactggaagatcagctttatccccggcccagcg
ctgatgcagagcagcgtacctgcgtcgatgctcggcctggctcttttgcttgccctgggc
ggcgccgtgatcggcctgatcctggtgcaaggcgccctgcaacggcgcgtcaacctcgat
gcagggcagctcggacaaatgctgaaagaactctctgccggcaagaacgtcaaagccttc
agcctcagcgtgccggcactcgatacgctggcacagagcctggcgcgcttgccgcgccgc
agcagccctgaaggcagcagtacccccgttaaaggaacagccgcggcacccgccactcag
ccggcagccaagccagccgagctggtcgacccgctgtttcaggacaccgatatcctcgat
atcgacattctcgatgaagaccaggatctcctgggactggagcagagccccgcaatgagc
actagccaaagcgccccgaaacttcccgccgacattttccgtgcctacgacattcgtggc
gtggtgggtgacaccctgaccgccgaatacgcctactggatcggccgcgccatcggctcg
aagagcctggcccagggcgagcccaaggtcatcgttggccgtgacggccgcctgtccggc
cccgaactgctgcagcaactggtacagggcctgctcgactgcggctgcgaagtcactgat
atcggcatggtgccgaccccagtggtgtacttcgctgccaacgtgctggagggccgttcg
gccgtgatgctcaccggcagccacaacccgccggattacaacggcttcaagatcatcatc
gctggcgacaccctggccaacgagcagatccttgcgctgaagacccgcctggacaacaac
gacctggccagcggcgtcggcagcgtgcagcaggtcgacgtgctgcagcgctatttcaag
accatccgtgacgacatcgccctggccaagccactgcgcgtggtggtcgactgcggcaat
ggcgccgcgggcgtgatcgccccgcaactgatcgaggcgctgggctgcagcgtgattccg
ctgttctgcgaagtggacggcaccttccccaaccaccacccggatccgggcaagccggag
aacctggtcgacctgatcgcccgcgtcaaatccgagaatgccgacctgggcctggcgttc
gacggcgacggcgaccgcgtcggcgtggtgaccaacaccggcaccatcgtctacccggac
cgcctgctgatgctgttcgccaaggacgtggtctcgcgtaaccccggcgccgacatcatc
ttcgacgtcaaatgcacccgtcgcctgaccccgctgatcagtggctacggtggccgtccg
gtgatgtggaagaccggccactctctgatcaagaagaaaatgaaggaaaccggcgccctg
ctggctggcgagatgagcggtcacatcttcttcaaggagcgctggtacggtttcgacgat
ggtatctacagcgctgcgcgcctgctggagatcctcagcctcgagaaacgcaacgccgag
caggtgttcagcgccttccccagcgacatttccacgccggaaatcaacatcaaggtcacc
gagcaaaccaagttcggcatgatcgagcggctgcagcgcgaaggccaatggggcgaggcg
aacatcaccagcatcgacggcgtgcgcgtcgactatcccaagggctggggcctgatccgc
gcctccaacaccacgccggtgctggtgctgcgcttcgaagccgacacccaggaagagctg
gagcgtatccaggacgtcttccgcacccaattgctcaaggtcgcccccgacctgcaacta
cccttttga

DBGET integrated database retrieval system