KEGG   Pseudomonas mendocina NK-01: MDS_4719Help
Entry
MDS_4719          CDS       T01473                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MDS_4719
Enzymes [BR:pmk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MDS_4719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5167362..5167979
Genome map
AA seq 205 aa AA seqDB search
MATTGTLYIVSAPSGAGKTSLVKALIESEPQIRVSVSHTTRAMRPGEQDGVNYHFVDHAQ
FSAMIERSEFLEHAQVFDNFYGTSQKWVEQTLAEGFDLILEIDWQGAQQVRKLMPQAKSI
FILPPTQEALRHRLTNRGQDSGEIIERRMREAVSEMSHYVEYDYLVINDDFNHALSDLKA
IFRSNQLAQTQQQQRHAGLLSELLA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaccggcaccctctatatcgtttccgcaccctccggcgccggcaagaccagc
ctggtcaaggcactgatcgagagcgagccgcagattcgcgtctcggtctcgcacaccact
cgcgccatgcgtcccggcgagcaggacggggtcaactaccacttcgtcgaccacgcccag
ttcagcgccatgatcgagcgcagcgagtttctcgagcatgcccaggtgttcgacaatttc
tacggcacctcgcagaaatgggtcgagcagaccctggccgaaggtttcgacctgatcctg
gagatcgactggcagggcgcgcagcaggtacgcaagctgatgccgcaggccaagtccatc
ttcatcctgccgccgacccaggaagcgctgcgccatcgcctgaccaatcgcggccaggac
agcggcgaaatcatcgagcggcgcatgcgcgaagcggtcagcgaaatgagccactatgtc
gagtacgactacctggtgatcaacgatgacttcaatcacgccctgagcgacctgaaagcc
atcttccgcagcaaccagctggcacaaactcagcaacagcagcgccatgccggcctgctc
agcgaactgctggcgtaa

DBGET integrated database retrieval system