KEGG   Pseudomonas mendocina NK-01: MDS_4925Help
Entry
MDS_4925          CDS       T01473                                 

Definition
protoporphyrin IX magnesium-chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MDS_4925
Enzymes [BR:pmk01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MDS_4925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5398006..5399007)
Genome map
AA seq 333 aa AA seqDB search
MTDLHFPLAAVVGADSLKLALCLAAIDPAIGGVLIEGPRGMAKSTLARGLADLLDGGRFV
TLPLGASEERIIGTLDLDAALGEGRAQFSPGLLARADGGVLYVDEVNLLPDHLVDLLLDA
AASGVNHVERDGISHRHAARFVLIGTMNAEEGELRPQLLDRFGLNLVLDGQPQPAERAEI
VRRRLAFDAGPEAFLQRWQGEQAALAARCENARLRLADIPLDDAALGEISQRCFAAGVDG
LRADLVWLRAARAHAAWRGVAGIEPVDIDAVEDFVLRHRRRQPQPPAATPPEQAQAPQQA
QEQSQGEGQWGELPAQPQAMGERRVPPRWPKKP
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctccacttcccgctcgccgccgtggtgggcgccgactcgctgaagctggcg
ctgtgcctggcagccatcgatccggccatcggcggtgtgctgatcgaagggccgcgcggc
atggccaagtccacactggcccgtggcctggccgatctgctcgatggcgggcgcttcgtt
accctgccgttgggggcgagcgaggagcgcatcatcggcaccctggatctggacgccgcg
ctgggcgaaggccgtgcgcagttttcccccggcctgctggcccgcgccgacggcggcgtg
ctctatgtcgatgaggtcaacctgctgccggatcatctggtcgacctgctgctcgatgcc
gctgccagcggcgtcaaccatgtcgagcgtgacggcatctcccatcggcatgccgcgcgc
ttcgtgctgatcggcaccatgaatgccgaggaaggcgaactgcgcccgcaactgctcgac
cgcttcggcctcaacctggtcctcgatggccagccgcagccggccgagcgcgccgagatc
gtccgccgccgcctggccttcgatgcgggccccgaagcctttctgcaacgctggcagggc
gagcaggctgccctcgcggcccgttgcgagaatgcccgcctgcgcctggccgatatcccg
ttggatgacgctgccttgggtgagatcagccaacgttgcttcgctgccggtgtcgatggc
ttgcgcgccgatctggtctggctgcgtgccgcccgtgctcatgccgcttggcgtggggta
gcgggaatcgagcctgtggatatcgatgcggtggaggacttcgtcctgcgtcaccgtcgt
cgtcagccacaaccgccggctgccacgccgcccgagcaggcccaggcgccgcagcaggcg
caggaacagagccagggagagggccagtggggcgagttgccggcccagccgcaggccatg
ggcgaacgacgcgtgccgccgcgctggccaaaaaagccctga

DBGET integrated database retrieval system