KEGG   Candidatus Phytoplasma mali: ATP_00105Help
Entry
ATP_00105         CDS       T00729                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pml  Candidatus Phytoplasma mali
Pathway
pml00010  Glycolysis / Gluconeogenesis
pml00030  Pentose phosphate pathway
pml00051  Fructose and mannose metabolism
pml00680  Methane metabolism
pml01100  Metabolic pathways
pml01110  Biosynthesis of secondary metabolites
pml01120  Microbial metabolism in diverse environments
pml01130  Biosynthesis of antibiotics
pml01200  Carbon metabolism
pml01230  Biosynthesis of amino acids
pml03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:pml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ATP_00105 (pfkA)
   00030 Pentose phosphate pathway
    ATP_00105 (pfkA)
   00051 Fructose and mannose metabolism
    ATP_00105 (pfkA)
   00052 Galactose metabolism
    ATP_00105 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    ATP_00105 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ATP_00105 (pfkA)
Enzymes [BR:pml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ATP_00105 (pfkA)
Protein phosphatases and associated proteins [BR:pml01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ATP_00105 (pfkA)
Messenger RNA biogenesis [BR:pml03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ATP_00105 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: CAP18292
UniProt: B3R0C8
Position
complement(141328..142287)
Genome map
AA seq 319 aa AA seqDB search
MNIAVLTSGGDSPGMNAAIRSIVKVGIQNNISIYGIKYGYLGLYQNQMDLLKLEDVENII
RMGGTFLGTSRFIEFIENTNIIQKSVQNLKNKDISVLIIIGGNGSYKGALKLIDFGVKCI
GIPGTIDNDISGTEFTIGFHTALNTIVESIDKIKDTSKSHKRCTLVEVMGRQKGDLALYS
SICNENNLVIIPEYNNSKLNVLKKMQSFRNQEQSHAIVILTERQFDINVLAKEIELVSGF
ETKITILGHTQKGGIPLPQDRILGTLMGFYSIEMIRKNFFNIALGIRNNKIISYPFTEVL
ESKKDDIFQSLWEINNQLI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagctgttttaacgtcaggcggagattcaccaggaatgaacgcagctattaga
agtatcgttaaagttggcatacaaaataatatatcaatttacggaattaaatatggttat
ttaggtttatatcaaaatcaaatggatttgttaaaattagaagatgtagaaaatattatt
agaatgggtggtacttttttagggacttcacgttttattgaatttatagaaaatacaaat
attattcaaaaatcagttcaaaatttaaaaaataaagatatttcagttttaattattatc
ggcggtaatggttcttataaaggtgctttaaaattaattgattttggtgttaaatgtatt
ggaataccaggaactattgataatgatatttcaggtactgaatttactattggttttcat
acagctttaaatactattgttgaatctattgataaaattaaagatacttctaaatcacat
aaaagatgtaccttagtagaagttatgggtagacaaaaaggtgatttagctctttatagt
tctatttgtaacgaaaataatttagttattattcctgaatataataatagtaaactaaat
gttttaaaaaaaatgcaatcttttcgaaatcaagaacaaagtcatgcaattgtaatatta
acagaacgtcaatttgatattaatgttttagcaaaagaaattgaattagttagtggtttt
gaaactaaaataactattttaggtcatactcaaaaaggcggaattcctctacctcaagat
cgtattttaggaactttaatgggtttttattccatcgaaatgattagaaaaaattttttt
aatattgctttaggaattagaaataataagattatttcttatccttttacagaagttttg
gaaagtaaaaaagatgatatatttcaatcattatgggaaattaataaccaattaatttaa

DBGET integrated database retrieval system