KEGG   Candidatus Phytoplasma mali: ATP_00105Help
Entry
ATP_00105         CDS       T00729                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pml  Candidatus Phytoplasma mali
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ATP_00105 (pfkA)
   01230 Biosynthesis of amino acids
    ATP_00105 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ATP_00105 (pfkA)
   00030 Pentose phosphate pathway
    ATP_00105 (pfkA)
   00051 Fructose and mannose metabolism
    ATP_00105 (pfkA)
   00052 Galactose metabolism
    ATP_00105 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    ATP_00105 (pfkA)
Enzymes [BR:pml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ATP_00105 (pfkA)
Protein phosphatases and associated proteins [BR:pml01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ATP_00105 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(141328..142287)
Genome map
AA seq 319 aa AA seqDB search
MNIAVLTSGGDSPGMNAAIRSIVKVGIQNNISIYGIKYGYLGLYQNQMDLLKLEDVENII
RMGGTFLGTSRFIEFIENTNIIQKSVQNLKNKDISVLIIIGGNGSYKGALKLIDFGVKCI
GIPGTIDNDISGTEFTIGFHTALNTIVESIDKIKDTSKSHKRCTLVEVMGRQKGDLALYS
SICNENNLVIIPEYNNSKLNVLKKMQSFRNQEQSHAIVILTERQFDINVLAKEIELVSGF
ETKITILGHTQKGGIPLPQDRILGTLMGFYSIEMIRKNFFNIALGIRNNKIISYPFTEVL
ESKKDDIFQSLWEINNQLI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagctgttttaacgtcaggcggagattcaccaggaatgaacgcagctattaga
agtatcgttaaagttggcatacaaaataatatatcaatttacggaattaaatatggttat
ttaggtttatatcaaaatcaaatggatttgttaaaattagaagatgtagaaaatattatt
agaatgggtggtacttttttagggacttcacgttttattgaatttatagaaaatacaaat
attattcaaaaatcagttcaaaatttaaaaaataaagatatttcagttttaattattatc
ggcggtaatggttcttataaaggtgctttaaaattaattgattttggtgttaaatgtatt
ggaataccaggaactattgataatgatatttcaggtactgaatttactattggttttcat
acagctttaaatactattgttgaatctattgataaaattaaagatacttctaaatcacat
aaaagatgtaccttagtagaagttatgggtagacaaaaaggtgatttagctctttatagt
tctatttgtaacgaaaataatttagttattattcctgaatataataatagtaaactaaat
gttttaaaaaaaatgcaatcttttcgaaatcaagaacaaagtcatgcaattgtaatatta
acagaacgtcaatttgatattaatgttttagcaaaagaaattgaattagttagtggtttt
gaaactaaaataactattttaggtcatactcaaaaaggcggaattcctctacctcaagat
cgtattttaggaactttaatgggtttttattccatcgaaatgattagaaaaaattttttt
aatattgctttaggaattagaaataataagattatttcttatccttttacagaagttttg
gaaagtaaaaaagatgatatatttcaatcattatgggaaattaataaccaattaatttaa

DBGET integrated database retrieval system