KEGG   Candidatus Phytoplasma mali: ATP_00105Help
Entry
ATP_00105         CDS       T00729                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pml  Candidatus Phytoplasma mali
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:pml01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pml01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pml00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pml00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pml00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism
Metabolism; Energy metabolism; Methane metabolism [PATH:pml00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(141328..142287)
Genome map
AA seq 319 aa AA seqDB search
MNIAVLTSGGDSPGMNAAIRSIVKVGIQNNISIYGIKYGYLGLYQNQMDLLKLEDVENII
RMGGTFLGTSRFIEFIENTNIIQKSVQNLKNKDISVLIIIGGNGSYKGALKLIDFGVKCI
GIPGTIDNDISGTEFTIGFHTALNTIVESIDKIKDTSKSHKRCTLVEVMGRQKGDLALYS
SICNENNLVIIPEYNNSKLNVLKKMQSFRNQEQSHAIVILTERQFDINVLAKEIELVSGF
ETKITILGHTQKGGIPLPQDRILGTLMGFYSIEMIRKNFFNIALGIRNNKIISYPFTEVL
ESKKDDIFQSLWEINNQLI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagctgttttaacgtcaggcggagattcaccaggaatgaacgcagctattaga
agtatcgttaaagttggcatacaaaataatatatcaatttacggaattaaatatggttat
ttaggtttatatcaaaatcaaatggatttgttaaaattagaagatgtagaaaatattatt
agaatgggtggtacttttttagggacttcacgttttattgaatttatagaaaatacaaat
attattcaaaaatcagttcaaaatttaaaaaataaagatatttcagttttaattattatc
ggcggtaatggttcttataaaggtgctttaaaattaattgattttggtgttaaatgtatt
ggaataccaggaactattgataatgatatttcaggtactgaatttactattggttttcat
acagctttaaatactattgttgaatctattgataaaattaaagatacttctaaatcacat
aaaagatgtaccttagtagaagttatgggtagacaaaaaggtgatttagctctttatagt
tctatttgtaacgaaaataatttagttattattcctgaatataataatagtaaactaaat
gttttaaaaaaaatgcaatcttttcgaaatcaagaacaaagtcatgcaattgtaatatta
acagaacgtcaatttgatattaatgttttagcaaaagaaattgaattagttagtggtttt
gaaactaaaataactattttaggtcatactcaaaaaggcggaattcctctacctcaagat
cgtattttaggaactttaatgggtttttattccatcgaaatgattagaaaaaattttttt
aatattgctttaggaattagaaataataagattatttcttatccttttacagaagttttg
gaaagtaaaaaagatgatatatttcaatcattatgggaaattaataaccaattaatttaa

DBGET integrated database retrieval system