KEGG   Candidatus Phytoplasma mali: ATP_00154Help
Entry
ATP_00154         CDS       T00729                                 

Gene name
aceF
Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2 (lipoate acyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pml  Candidatus Phytoplasma mali
Pathway
pml00010  Glycolysis / Gluconeogenesis
pml00020  Citrate cycle (TCA cycle)
pml00620  Pyruvate metabolism
pml01100  Metabolic pathways
pml01110  Biosynthesis of secondary metabolites
pml01120  Microbial metabolism in diverse environments
pml01130  Biosynthesis of antibiotics
pml01200  Carbon metabolism
Module
pml_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ATP_00154 (aceF)
   00020 Citrate cycle (TCA cycle)
    ATP_00154 (aceF)
   00620 Pyruvate metabolism
    ATP_00154 (aceF)
Enzymes [BR:pml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ATP_00154 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_D23 HlyD_3 GCV_H PTS_EIIA_1 PYNP_C
Motif
Other DBs
NCBI-ProteinID: CAP18341
UniProt: B3R0H7
Position
complement(196639..197898)
Genome map
AA seq 419 aa AA seqDB search
MFELKFADVGEGIDEGTVLKVYFQIGDKVKEGDILVTVETDKVNADLPAPINGVITKLGV
KEGEMIHVGDMVAIIGDEIHETELKKADKEDDAGVVGDLENSSQIIETFNDNHVLNEINL
SEKKILTTPLVRSMAKKLGIDLNNVNGSGINGKILKEDVERYQNENLKNSTSTIQKQNIK
EQQSLNNLDFSSFDSEVIKISRLRKAISEQMKISKNAIVPTTLLNEINIDNLIAFRKKLK
FEADSKNIKLTYMAFIMKAIVIVLKEFPIFNSSFNEVKDEIIIKKNINLGIAVDTEDGLI
VPNIKNADKMNILELAKELEIIAKETRERKVSIEKLKNGTFTITNFGALGLIYGTPIINY
PETAILGIGTIIKKPIVEQEEIIIANMLPLSLTIDHRIIDGADGGRFLKRFQEILNNLS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaattaaaattcgctgatgttggtgaaggcattgatgaaggaactgttttaaaa
gtatattttcaaatcggtgataaagttaaagaaggcgatattttagttacagtagaaaca
gataaagtaaatgcagatttaccagctccaataaatggtgttattactaaattaggagtt
aaagaaggtgaaatgatccatgttggtgatatggtagctataataggtgatgaaattcat
gaaactgaattaaaaaaagcagataaagaagatgatgcaggagtagtcggagatttagaa
aattcttctcaaattatagaaacatttaatgataaccatgttttaaatgaaattaattta
agtgaaaaaaaaattctaaccactcctttagtacgttctatggctaagaagttaggaata
gatttaaataatgttaatggtagtgggattaatggcaaaatcttgaaagaagatgtcgaa
agatatcaaaatgaaaatttaaaaaattcaacttcaacaatacaaaaacaaaatataaaa
gaacaacaatcattaaataatcttgattttagtagttttgatagtgaagttattaaaatt
tctcgtttaagaaaagctatttcagaacaaatgaaaatttcaaaaaatgctattgttcct
actactttattaaatgaaattaatattgataatttgatagcatttaggaaaaaattaaaa
tttgaagcagattctaaaaatattaaattaacttacatggcttttattatgaaggcgatt
gttattgttttaaaagaatttccaatttttaattctagttttaatgaagttaaagatgaa
attattattaagaaaaatattaatttaggaattgctgttgatactgaagatggtttaata
gttcctaatattaaaaatgctgataaaatgaatattttagaattagcaaaagaactagaa
ataatagcaaaagaaacaagagaaagaaaagtttctatagaaaaattaaaaaatggtact
tttacaattaccaattttggagctcttggtttaatttatggaactcctattataaattat
ccagaaacagcaattttaggcattggtacaataattaaaaaaccaatagttgaacaagaa
gagataattattgctaatatgttacctttatctttaactattgatcatagaattattgat
ggagcagacggaggaagatttttaaaaagatttcaagaaattttaaataatctttcttaa

DBGET integrated database retrieval system