KEGG   Candidatus Phytoplasma mali: ATP_00168Help
Entry
ATP_00168         CDS       T00729                                 

Gene name
ruvA
Definition
Holliday junction resolvasome, DNA-binding subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pml  Candidatus Phytoplasma mali
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pml03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(215534..216094)
Genome map
AA seq 186 aa AA seqDB search
MYSYIKGKVVNNGQNFVIVDNNNIGYHIIVSNPYFYEINKEYKFFVHFHIKENLQILYGF
NDNKNLLFFKKLLDVPTIGPKSALMLSETDNLEQVFQAIENNDNVYLRKFPGIGIKSAQQ
IILKLKGDLIFSEKIILNPKKTELEKILLNLGFVKKEIKSVLNQIDDKKELELMLKEVLL
KLAKNI
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtattcttatattaaaggtaaggtagtaaacaacggtcaaaactttgttatagttgat
aataataatattggttaccatattatagtttctaatccctatttttatgaaattaataaa
gaatataaattttttgttcattttcatattaaagaaaatttacaaattttatacggtttt
aatgataataaaaatttattattttttaaaaaattactagatgtacccactataggacct
aaaagtgctttaatgctttctgaaactgataatttagaacaagtttttcaagctattgaa
aataatgataatgtatatttaagaaaatttccaggaattggtataaaatcagctcaacaa
attattttaaaacttaaaggtgatttaatattttcggaaaaaataatattaaatccaaaa
aaaacagaactggaaaaaattttattaaacttaggttttgttaaaaaagaaattaaatct
gttttaaatcaaattgatgataaaaaagaactagaattaatgctaaaagaagttttatta
aaattagcaaaaaatatttaa

DBGET integrated database retrieval system