KEGG   Candidatus Phytoplasma mali: ATP_00321Help
Entry
ATP_00321         CDS       T00729                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pml  Candidatus Phytoplasma mali
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pml00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:pml00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
403794..404267
Genome map
AA seq 157 aa AA seqDB search
MISLITALDPNFLIGNCNMLPWHYPQDLKFFKKMTNNKNVLMGYCTYKSLKKYYKNKNFL
FQKTYVASFDQSLQLPDAIVINNLFNFLKNIQDEIIIIGGSQIYKQTLPYINILYVTHIL
TRFQGDSFFPFVNLKKYKIVSKKIYPELIFVEYHKIS
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgattagtttaattactgctttagatcctaattttttgattggcaattgtaatatgctt
ccttggcattatccccaagatttaaaattttttaaaaaaatgactaataataaaaatgtt
ttgatgggttattgtacttataaatctttaaaaaaatattataaaaataaaaatttttta
tttcaaaaaacttatgttgcaagttttgatcagtcattacaattacctgatgcaattgtt
ataaataatttgtttaattttttaaaaaatattcaagatgaaataattataattggcgga
agtcaaatttataaacaaacgttaccttatataaatatactttatgttactcatatttta
acaagatttcaaggagattcattttttccttttgttaatctaaaaaaatataaaattgta
tctaaaaaaatttatcccgaattaatttttgttgagtatcataaaattagttaa

DBGET integrated database retrieval system