KEGG   Candidatus Phytoplasma mali: ATP_00447Help
Entry
ATP_00447         CDS       T00729                                 

Gene name
gmk
Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pml  Candidatus Phytoplasma mali
Pathway
pml00230  Purine metabolism
pml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pml00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ATP_00447 (gmk)
Enzymes [BR:pml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     ATP_00447 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 ATP-synt_ab Sigma54_activat AAA_22 AAA_16 AAA_29 DUF3781
Motif
Other DBs
NCBI-ProteinID: CAP18634
UniProt: B3R0Q0
Position
533544..534176
Genome map
AA seq 210 aa AA seqDB search
MKLNKKGLLIIISGPSGVGKETVRKALFNIKNHNFIYSISFTTRPQRSYEKQGKNYYFVS
EKQFLNYINKDYFLEWAKFLGYYYGTPRNAIEEDMKKGKEVIVEVEVEGALKIREKNIKD
AVFIFIVPPSKKSLYDRLKKRGTETEQIIQQRIQKADKEFLLAYKYDYIVMNDEINNAAN
RIISIISAEHSKTKRSIYTYFKILEGEKIK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaacaaaaaaggacttttaattattatttctggtccttctggcgttggtaaa
gaaactgtaagaaaagctttatttaatattaaaaatcataattttatttattctatttct
tttactactaggccgcaaagatcatatgaaaaacaaggaaaaaattattattttgtttct
gaaaaacaatttttaaattatattaataaagattattttttagaatgggctaagttttta
ggttattattatggtacacctcgtaatgctattgaagaagatatgaaaaaaggtaaagaa
gttattgtagaggtagaagttgaaggggctttaaaaattagagaaaaaaacattaaagat
gctgtttttatttttattgttccaccgagtaagaaaagtttatatgatcgtttgaaaaaa
agaggaacagaaacagaacaaattatacaacaaagaattcaaaaagcagataaagaattt
ttacttgcttataaatatgattatattgttatgaatgatgaaattaacaatgctgctaat
agaataatttctattataagtgcagaacattctaaaactaaaagaagtatttatacttat
tttaaaattttagaaggagagaaaattaaatga

DBGET integrated database retrieval system