KEGG   Prochlorococcus marinus MED4: PMM0164Help
Entry
PMM0164           CDS       T00142                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase, beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pmm  Prochlorococcus marinus MED4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PMM0164 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PMM0164 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PMM0164 (trpB)
Enzymes [BR:pmm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PMM0164 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(159422..160666)
Genome map
AA seq 414 aa AA seqDB search
MVSTISRQDQNNNDDLNQPSKEGRFGKYGGQYVPETLMPALFELEEAASDAWKDKQFVNE
LNHLLKTYVGRETPLYEAKRLTEHYQTKTSTSRIWLKREDLNHTGAHKINNALGQALLAI
RMGKQRIIAETGAGQHGVATATVCARFGLQCIIYMGAEDIKRQSLNVFRMKLLGAEVKVV
TSGTATLKDATSEAIRDWVSNVETTHYILGSVAGPHPFPMIVRDFHAVIGEEAKKQCLES
FGSLPDILLACVGGGSNAMGLFHPFVKEKSVRLIGVEAAGSGVNTEKHAATITKGSVGIL
HGSMSLLLQDKDGQVQEAHSISAGLDYPGVGPEHSYLKDIGRAEYGSVTDAEALDALKLV
SELEGIIPALETAHAFAWLEKLCPTLDKDTEIVINCSGRGDKDVNTVASSLNID
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
ttggtaagtacaatttctcgtcaggatcaaaataataatgatgatttaaatcaaccttca
aaagaaggaagatttggaaaatatggaggtcaatatgtccctgaaacattaatgccagct
ctttttgaactggaagaagcagcttctgatgcatggaaagataaacaatttgttaatgaa
ttaaatcatttgctgaaaacttatgtaggaagagagaccccactatatgaggctaaaaga
cttactgaacattaccagacaaaaacatctaccagcaggatatggctcaaaagagaagac
ctaaatcatactggtgctcacaaaatcaataatgcattaggtcaagctttattagcgata
agaatgggtaaacaaagaataattgcagaaacaggggctgggcaacacggagttgctact
gctactgtatgcgcgagatttggtttgcaatgcattatctacatgggggcagaagatata
aaaagacaatcattaaatgtctttcggatgaaacttttaggcgcagaagttaaagttgtt
acttcaggtactgcgactctcaaagacgcaactagtgaagcaatcagggattgggtatca
aatgtagaaacaacgcactatattttggggtcagttgcagggccacacccatttccaatg
atcgtaagagattttcatgcagttataggagaagaagcaaaaaaacaatgtctagaatca
tttggatctttacctgatattttgcttgcttgcgtaggtggaggatcaaatgcaatgggt
ctttttcatcctttcgtaaaagaaaaatcagttcgacttattggagttgaagcggcaggg
agtggagtcaatactgaaaaacatgccgcgactattactaaaggatccgtaggaatttta
catgggtcaatgagtcttcttttacaagataaggatggtcaagtacaagaagcgcattct
ataagcgcaggtcttgattatcctggggtaggtcctgaacatagttatttaaaagatata
gggagagcagaatatgggtctgttactgatgcagaagctttagacgctttgaaactagtc
agtgaactagaaggaattatccctgcactcgaaacagctcatgcctttgcatggttagaa
aaattatgtcctaccttggataaagatactgaaatagtaattaattgttctggtagagga
gataaggatgttaatactgtcgcatcatctttgaatattgattaa

DBGET integrated database retrieval system