KEGG   Prochlorococcus marinus subsp. pastoris CCMP1986: PMM0215Help
Entry
PMM0215           CDS       T00142                                 

Definition
(GenBank) Delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
pmm  Prochlorococcus marinus subsp. pastoris CCMP1986
Pathway
pmm00860  Porphyrin and chlorophyll metabolism
pmm01100  Metabolic pathways
pmm01110  Biosynthesis of secondary metabolites
pmm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pmm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PMM0215
Enzymes [BR:pmm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PMM0215
Exosome [BR:pmm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PMM0215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: CAE18674
CYORF: PMM0215
UniProt: Q7V370
Position
209144..210145
Genome map
AA seq 333 aa AA seqDB search
MNLIIRPRRLRRTDAIREMVRENHLHPQDFIYPLFIHEKDFQEEISAMPGIYRWDMNGLI
KEVSRAWELGIRCIVLFPKIDDSLKTEDGSECFNEAGLIPKAIRILKKEIPEMAIMTDVA
LDPYSCDGHDGLVDDNGKILNDETIEILKKQAITQARAGADFIGPSDMMDGRVGAIRTAL
DIEGFSDVGIISYTAKFSSAYYGPFRTALDSAPKENNRKIIPDNKSTYQMDPANSREALI
ESALDQYEGADILMVKPGVSYLDIVYRLSTFSNKPIAAYNVSGEYSMVKAAAMKNWINEK
DIVLETLLSFKRAGAKLILTYHACDASKWLNEK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgatcattcgcccaagaagattgagaaggacagacgcaataagagagatggta
agagaaaaccatctgcatcctcaagattttatatatccactgtttattcacgaaaaggat
ttccaagaagaaatatctgcaatgcctggtatttatagatgggacatgaatggattaatt
aaggaagtttctagagcctgggaattaggtattagatgtattgtactttttccaaaaatt
gacgatagtttaaaaacagaagacggatcagaatgtttcaatgaagctggtttaatacct
aaggctattcgaatattaaaaaaagagatccctgagatggcaattatgactgatgttgcc
ttagatccctattcatgtgatggacatgatggcttggttgatgacaatggaaaaatattg
aatgatgaaaccattgagattctgaaaaaacaggctattactcaagcaagagcgggagca
gattttattggtccaagtgacatgatggatgggagagttggagctataagaactgctttg
gatattgagggatttagcgatgtgggaattattagctataccgcaaaattttcatctgct
tattatggtccttttagaacagcattagattctgccccgaaagagaataataggaaaata
attccagataataaatcaacatatcaaatggatcctgctaactctagggaggctttaatt
gaatcggcattagatcaatatgagggtgcagatattttgatggttaagcctggtgtctct
tatctagacatagtttatcggctgagtactttttcaaataaaccaatagctgcttataac
gtgagtggagaatattcaatggtaaaggctgctgctatgaaaaattggattaatgaaaag
gatattgttttagaaacattgcttagttttaaaagagcaggggcaaaattaatactcacc
tatcatgcttgtgatgcatcaaaatggttgaatgagaagtaa

DBGET integrated database retrieval system