KEGG   Prochlorococcus marinus subsp. pastoris CCMP1986: PMM0233Help
Entry
PMM0233           CDS       T00142                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pmm  Prochlorococcus marinus subsp. pastoris CCMP1986
Pathway
pmm00240  Pyrimidine metabolism
pmm00250  Alanine, aspartate and glutamate metabolism
pmm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PMM0233 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PMM0233 (pyrB)
Enzymes [BR:pmm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     PMM0233 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: CAE18692
CYORF: PMM0233
UniProt: Q7V355
Position
complement(226153..227169)
Genome map
AA seq 338 aa AA seqDB search
MGNWPHKHILTLSNFSIDDYESVIELTERFKSLNNAGTKKIPALQGKLITSIFFEASTRT
RNSFELAAKRLSADVQSFSPSSSSLSKGETLIDTALTYAAMGSDILVIRHSSSHVPLEIS
KKLDASKAKTSVLNAGDGLHSHPSQGLLDLYTLIKFFSPKLLKPEILNSKKILIVGDVIH
SRVARSNLWALTAFGANIILCGPPTLIPEEFTDFVSSSPPNQLRDPISSRGSITISSSLE
ESIKCADAVIVLRLQKERMIENLLSSIKSYSENYCLTPEKLSLNCKDIPILHPGPINRGI
EISSRVVDEYPNCLINDQVSNGIPTRMALLYLLSKFNN
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgggaaattggcctcacaaacatatcctcacactttcaaatttctcaatagatgattac
gaatcagttattgagttaactgaaagatttaaatctcttaataatgccgggacaaaaaaa
atacctgctttacaaggaaagttaataacatcaatattttttgaggctagtactagaact
cgcaatagttttgagcttgctgccaaaaggctatctgcagatgttcaaagcttttctcct
tcttcaagttctttaagtaaaggagaaaccctcatagatactgcactaacatatgctgcc
atggggtctgatattttagtcattagacattcatctagccatgtccctttagaaatttcc
aaaaaactcgatgcatctaaagcaaaaacttcggttcttaatgcaggtgatggtttacat
agccaccctagtcaaggattactagatctttatacattaataaaattcttttctccaaaa
ttactgaaaccagagatattaaattctaaaaaaatattaatagttggtgatgtaattcac
tctagagttgccagatcaaatctttgggcattgaccgcatttggggcaaacataatcttg
tgtggtccacccacacttattcctgaagaatttactgattttgtaagtagttctccacca
aatcaattaagagaccctatttcttcaagaggttctatcacaatttcgagttcattagaa
gaatccattaaatgtgcagatgcagtaattgttttaagattacaaaaagaaagaatgata
gagaatttattaagcagtattaaatcgtatagtgaaaattattgtttgactccagaaaaa
ctatccttgaattgtaaagatattcctattttgcacccagggcctattaatcgtggcatt
gaaatcagcagcagagttgttgatgaatatccaaattgcctaataaatgatcaagtttca
aatggtattccgacaagaatggctttactttatctattaagtaaattcaataattaa

DBGET integrated database retrieval system