KEGG   Prochlorococcus marinus subsp. pastoris CCMP1986: PMM0287Help
Entry
PMM0287           CDS       T00142                                 

Gene name
folK
Definition
(GenBank) possible 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pmm  Prochlorococcus marinus subsp. pastoris CCMP1986
Pathway
pmm00790  Folate biosynthesis
pmm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PMM0287 (folK)
Enzymes [BR:pmm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PMM0287 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK Topoisom_I_N
Motif
Other DBs
NCBI-ProteinID: CAE18746
CYORF: PMM0287
UniProt: Q7V308
Position
complement(276559..277122)
Genome map
AA seq 187 aa AA seqDB search
MELSNLNIKNGLCISLGANIDSKFGSPLESLLICKPKIEEIINEWGDLYNNKKEEKRKFH
ANFFWSSIYETLPHGVENEQPNYLNTLLLIKSNSFPKTSNKNAKLLLKELKKLERFFGRK
ETPKGKKWLSRCLDLDILWWEDFYTVDEKLTLPHPRFMNRNFVITPLSEILSRSQKIKKF
DAPKWTI
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
gtggaattatcaaatcttaatatcaaaaatggactatgtatatccctgggagcaaatatt
gatagtaaattcggaagccctcttgagtcactattaatttgcaaaccaaaaatagaagaa
ataataaatgagtggggagatctttacaacaacaaaaaagaagagaaaagaaaatttcat
gcaaactttttttggtcatcaatttatgagacattacctcatggagttgaaaatgagcag
ccaaattatttaaatactctattgcttataaaaagtaattctttccctaaaacatcaaat
aaaaacgcgaaattacttttaaaagagctaaaaaagttagagaggtttttcggacgaaaa
gagacgccaaagggtaagaaatggctatcaagatgtctcgatttagatattctttggtgg
gaagatttttatacggttgacgagaaattaacattacctcaccctagattcatgaatcgg
aatttcgttattacaccactatctgaaatcttaagtagaagccaaaaaatcaaaaagttt
gatgccccaaaatggactatataa

DBGET integrated database retrieval system