KEGG   Prochlorococcus marinus MED4: PMM0299Help
Entry
PMM0299           CDS       T00142                                 

Gene name
psbL
Definition
(GenBank) photosystem II PsbL protein
  KO
K02713  
photosystem II PsbL protein
Organism
pmm  Prochlorococcus marinus MED4
Pathway
Photosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmm00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    PMM0299 (psbL)
Photosynthesis proteins [BR:pmm00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    PMM0299 (psbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
286189..286308
Genome map
AA seq 39 aa AA seqDB search
MQVNENPNKVPVELNRTSLYLGLLSVLVLGILFSSYFFN
NT seq 120 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtaaacgaaaatccgaataaagttccagttgaacttaatcgtacaagtctatat
ttaggcttattatcagtattagtcttaggaattttattttccagttactttttcaactaa

DBGET integrated database retrieval system