KEGG   Prochlorococcus marinus MED4: PMM0317Help
Entry
PMM0317           CDS       T00142                                 

Gene name
psbM
Definition
(GenBank) possible Photosystem II reaction center M protein (PsbM)
  KO
K02714  
photosystem II PsbM protein
Organism
pmm  Prochlorococcus marinus MED4
Pathway
Photosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmm00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    PMM0317 (psbM)
Photosynthesis proteins [BR:pmm00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    PMM0317 (psbM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
303280..303432
Genome map
AA seq 50 aa AA seqDB search
METTNFGFVASLLFVGIPTIFLIGLFISTQDGEKSSFYSDSSKGKLGPKR
NT seq 153 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaacaaattttggtttcgtagcaagtcttctatttgtaggaataccaactatt
ttccttattggattatttatttcaacccaagatggagaaaaatcaagcttttattcagat
tctagcaaagggaaacttggcccaaaacgctaa

DBGET integrated database retrieval system