KEGG   Prochlorococcus marinus subsp. pastoris CCMP1986: PMM0405Help
Entry
PMM0405           CDS       T00142                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoamide acetyltransferase component (E2) of pyruvate de
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pmm  Prochlorococcus marinus subsp. pastoris CCMP1986
Pathway
pmm00010  Glycolysis / Gluconeogenesis
pmm00020  Citrate cycle (TCA cycle)
pmm00620  Pyruvate metabolism
pmm01100  Metabolic pathways
pmm01110  Biosynthesis of secondary metabolites
pmm01120  Microbial metabolism in diverse environments
pmm01130  Biosynthesis of antibiotics
pmm01200  Carbon metabolism
Module
pmm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMM0405 (pdhC)
   00020 Citrate cycle (TCA cycle)
    PMM0405 (pdhC)
   00620 Pyruvate metabolism
    PMM0405 (pdhC)
Enzymes [BR:pmm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PMM0405 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding MadL
Motif
Other DBs
NCBI-ProteinID: CAE18864
CYORF: PMM0405
UniProt: Q7V2R4
Position
383670..385037
Genome map
AA seq 455 aa AA seqDB search
MSHEIFMPALSSTMTEGKIVEWLKNPGDKVERGESVLVVESDKADMDVESFQDGYLAAVL
MPAGSTAPVGETIGLIVENQDEIASIQEQNKGKQTEVSSDGQLELPNNKPEIKEEKQKEV
PQNNEQEVEIKREKVLITSNEIQFNASTSNNSSRVIASPRAKKLASTMGVELAKVHGSGP
HGRIQADDVLKANGQPVSIPWIGEGSSPASISSPHVQAESKSETLGNSFGNPGETVQFNT
LQKAVNKNMESSLNVPCFRVGYSINTDKLDNFYKKVKQNGVTMTALLVKAVAKTLKKHPQ
VNSSFSENGISYPENINIAVAVAMEDGGLITPVLKEPCNTDLFELSREWKDLVKRSRAKQ
LEPDEYSTGTFTLSNLGMFGVDRFDAILPPGTGAILAIASSKPTVVANNDGSISVKKIMQ
VNLTADHRVIYGADGASFLKDLSSLIENEPETLVA
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacgaaatatttatgccagctcttagttctactatgactgaaggcaaaattgtt
gaatggttaaagaatcctggagataaagttgaaagaggagaatctgttttagttgttgaa
tcagataaagctgatatggatgttgaatcttttcaagatggatatcttgctgcagtacta
atgccagctggtagtactgctccagttggtgaaaccattggacttattgtagagaatcag
gatgagatagcttctatacaagaacaaaataaaggtaaacagactgaagtatcaagtgat
ggtcaactcgaattaccaaataataaacctgaaataaaagaagaaaagcaaaaagaggtg
cctcaaaataatgagcaggaagtcgagattaaaagggaaaaagtgctaattacctctaat
gagattcaatttaacgcctctactagtaataattcttcaagagtaatagcatctccaagg
gcaaaaaaacttgcttctacaatgggagtcgaattagcaaaagtgcatggatcaggacct
catggaaggattcaggctgatgatgtattgaaggcaaatggccaacctgtgtctattcca
tggataggagagggaagttctcccgccagtatttctagtcctcatgttcaagccgaaagc
aagtcagagacattagggaatagttttggaaaccccggggaaactgtacaatttaatact
cttcaaaaagctgtaaataagaatatggaatcaagtttaaatgttccatgttttagagtt
gggtattcaattaatactgataaattggataatttttacaagaaagtaaagcaaaatgga
gttactatgactgcgttgttagtcaaggcagttgcaaagacacttaaaaaacatccccaa
gttaattcaagcttttcagaaaacggaatttcttatccagaaaatataaatattgctgtg
gctgttgctatggaagatggagggttgataactccagtattaaaagaaccttgtaacact
gatttatttgaattatctagagagtggaaagatcttgtgaaaagatctagagcaaaacaa
ttagaaccagatgaatactcaacaggaacatttactttgtcaaatttaggaatgtttggt
gttgacaggtttgatgcaatacttccaccaggtacaggtgcgattttagccatagcatca
tcgaagccaacagttgttgctaataatgatggctcaatatctgttaaaaaaataatgcaa
gtaaacttaaccgctgatcatagagtaatttatggtgctgatggtgcatcattcttaaaa
gacttgtcttctctcattgaaaacgagccagaaacacttgtagcctaa

DBGET integrated database retrieval system