KEGG   Prochlorococcus marinus MED4: PMM0536Help
Entry
PMM0536           CDS       T00142                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pmm  Prochlorococcus marinus MED4
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PMM0536 (folE)
Enzymes [BR:pmm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PMM0536 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
507372..508112
Genome map
AA seq 246 aa AA seqDB search
MTSTLPNDNIKNIDEKISNKLISEIIRDRIKSKGTRFSANDNIADFINPGELKVLEKEVA
SRIKDLLKSLVIDVDNDHNTQETAERVSKMYLNEVFKGRYHEQPKVTSFPNDKNLDEIYT
VGPITVRSACSHHLVPILGECWIGIKPGSKVIGLSKFARVADWVFSRPHIQEEAVMILAD
EIEKLCEPKGLGIIVKAQHYCMKWRGVKEPNTSMINSVVRGDFRHDISLKQEFFELVRQQ
SSNNNY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacttctacattacccaacgataatattaaaaatattgatgaaaagatttctaataaa
ttaatctccgagataataagggaccgtatcaaaagcaaaggtacaagattcagtgcaaat
gataatatcgctgactttattaatcctggtgagctaaaagttctagaaaaggaggtggct
tccagaattaaagatttacttaagtctttagttattgatgtggataatgaccacaatact
caggagacagcagaaagagtttcaaaaatgtacctaaacgaagtttttaaaggtagatac
catgaacagccaaaggttacaagtttcccaaatgataaaaaccttgatgaaatttatact
gtcggaccaataacagtgaggtccgcttgctctcatcatttagttccaattttaggagaa
tgttggataggaattaaaccaggtagtaaagttataggtctttctaaattcgctagagta
gcggattgggtattctctagaccacatatacaagaagaagcagtaatgattcttgcagat
gaaatagaaaaactatgtgaacccaaggggctaggcataatagtcaaagctcaacattac
tgtatgaagtggagaggagttaaagagccgaatactagcatgataaattcagtagttaga
ggagattttagacatgatataagcctaaaacaagaattttttgagctagtaagacaacaa
tcttctaataataattactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system