KEGG   Prochlorococcus marinus MED4: PMM0572Help
Entry
PMM0572           CDS       T00142                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pmm  Prochlorococcus marinus MED4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PMM0572 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PMM0572 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PMM0572 (trpA)
Enzymes [BR:pmm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PMM0572 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
538941..539780
Genome map
AA seq 279 aa AA seqDB search
MKENKKTQFPINKTLSKINKKFLELKKSDKLALMPFIMAGDPNIETTSEILLKLQEKGAD
LIELGIPYSDPLADGPIIQLSASRALKSGTTLKNVIQLLESLKDKLHIPIILFTYFNPVL
NFGLENFCELASKVGVSGLIIPDLPLEEAYKFSEIISSYSIDLILLVAPTTPSERMKIIS
NNTKGFTYLVSVTGVTGERNKMENRVENLITKLQEISINPVAVGFGISSPEHVNKVRKWG
ADGVIIGSAFVKRISNSNEKEVVNQIGKFCEEMRKAADQ
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaacaagaaaacgcaatttcctataaataaaactttatcaaaaataaataag
aagtttttggaactaaagaaaagcgataaattagcattgatgcccttcataatggcaggc
gatcctaatattgagactacatccgagattttattaaagttgcaagaaaagggtgcagat
cttattgaattaggaatcccttatagcgaccctcttgctgatggcccaataattcaatta
tcagcttctagagcattaaagtcaggaactacattgaaaaatgttattcaattattagag
tctttaaaagataagttgcatattccaataatacttttcacttattttaatcctgtatta
aattttggacttgagaatttttgtgaattggcatctaaagtaggagtctcaggattaata
attcccgatcttcctttggaagaagcatataaattttcagaaataattagttcttattct
atagacttgatattattagttgctcctactactccctctgaaagaatgaaaattatatct
aataatacaaaaggttttacttatttagtaagcgtaacaggagtaactggagagagaaac
aaaatggaaaatagagtagagaatcttattactaaattacaagaaataagcattaatcct
gtagcggttggttttggaatatcttctcctgaacatgttaataaagttcgtaaatggggg
gcagatggagtaattattggtagtgcatttgttaaaagaatctctaatagtaatgaaaag
gaagttgttaatcaaattggtaaattttgtgaagaaatgcgtaaagctgctgatcaataa

DBGET integrated database retrieval system