KEGG   Prochlorococcus marinus MED4: PMM0596Help
Entry
PMM0596           CDS       T00142                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pmm  Prochlorococcus marinus MED4
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PMM0596
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMM0596
   00052 Galactose metabolism
    PMM0596
   00500 Starch and sucrose metabolism
    PMM0596
   00520 Amino sugar and nucleotide sugar metabolism
    PMM0596
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PMM0596
   00524 Butirosin and neomycin biosynthesis
    PMM0596
Enzymes [BR:pmm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PMM0596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(565152..566189)
Genome map
AA seq 345 aa AA seqDB search
MNFLACDLGGTKVLLGIFKKEVNTCTPILILKKKYLSSEWDSIDTILEDFLKNECKNINH
PFSACFAVAGPISNNNAEIINLSWNISGDELKKKFKFKNCELVNDFAVQIYGIPFLKKSQ
YSAIQNGDRSVGVNKDLHAIVGAGTGLGIAKGIISGNKVKVLASEGGHVEYSPKSDLEWE
LKNWLKYSLKVERISCERIISGTGLSRIAEWRLSKPDAKNHPLQKYLKELKTSDNLRKEL
PQEICNLSNLGDKMMIEVERIWLDAYASLLGDVALQELCYGGLWISGGTAPKHFINFKSG
LFMKQFSDKGRLKDILKNIPVNVILDEEFGLFSAACRAKMLSQKE
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaattttcttgcttgtgatctaggaggtacaaaagttcttttaggaattttcaaaaag
gaagttaatacttgtactccaattttaattttaaaaaaaaaatatttatcttctgaatgg
gattcaattgacacaattttagaagatttcttaaaaaatgaatgcaaaaacattaatcat
cctttttctgcttgtttcgcggtagcaggtcccatatctaataataatgcggaaataatt
aatttatcgtggaatatttctggcgatgaattaaaaaagaaatttaaatttaaaaattgc
gagctagtaaacgattttgcagtgcaaatttatggaataccttttttgaaaaaaagtcaa
tattctgctattcaaaatggagaccggtcagtaggcgtcaataaagatttacatgcaatc
gttggagcaggaactggtctaggcattgcaaaaggcataatatctggaaataaagtaaaa
gttttagctagcgaaggtggtcatgttgaatactcgccaaagtcagatttagaatgggaa
ttaaagaattggctcaaatattctttaaaagttgaaagaatatcttgtgaaagaatcata
agtgggactgggttatcaagaatagctgagtggagacttagcaaacctgatgccaaaaac
catcctctacaaaaatacttaaaagaattaaaaacttctgataatttaagaaaagaactt
cctcaagaaatttgtaatctttctaatctaggggataagatgatgattgaagtggaaaga
atatggttagatgcttacgcctcattattgggtgacgttgctcttcaagaattatgttat
ggagggttatggatttctggaggaaccgctccaaaacatttcataaactttaaatcaggt
ttatttatgaaacaattttcagataaaggaagattaaaagatattcttaaaaatatacct
gtgaatgtaatcttagatgaagagtttggattatttagcgcagcctgcagagcaaaaatg
ctttcacaaaaagaataa

DBGET integrated database retrieval system