KEGG   Prochlorococcus marinus MED4: PMM0788Help
Entry
PMM0788           CDS       T00142                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pmm  Prochlorococcus marinus MED4
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pmm01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pmm00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(749890..750972)
Genome map
AA seq 360 aa AA seqDB search
MKKWVVKIGTSILRGNEDQSTEQVIESLCKSLTSFIFKGNKVILVTSGAVGLGCKKLNLN
TRPKELSALQAVAAVGQVNLMTLYEKTMKKLGHNIAQILITKTDFDSRESFNNASKTFQK
LIDLNVIPIVNENDSIANEELKYGDNDTLSALVALAINANKLILLTDIENLYSKDPRNNE
DAHPIKEVNSNQLKIIKDKNIQNYNNEWGTGGITTKLIAAEIATKGGVEVQLADGRNENN
LINIFNEKKIGTIFHPVDKPVGNKKSWLSHAIKTVGQITLDEGACLAIEQKGASLLVVGV
KEVEGDFTVNQAVRIVNTNKKEVAKGITSMSSDSLKRILNKKENINSSMIVVHRDVLALT
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatgggtcgtaaaaattggtactagtattctcagaggaaatgaggatcaatct
acagaacaagtaatagaaagtttatgtaaatctctaacaagttttatttttaaaggcaat
aaagtcattctcgtaacaagtggtgcggttggattaggatgtaaaaaattaaatttgaat
acaagaccaaaggaactcagtgcacttcaagctgtagctgcagtgggacaagttaattta
atgactttatatgaaaagacaatgaaaaagctaggtcataatatagctcaaatactaata
acaaaaactgattttgattcacgagaatccttcaataatgcttcaaaaacatttcaaaag
ttaattgatctgaatgtcatacctatagtcaacgagaatgattctattgccaatgaagag
cttaaatatggagacaatgatactctttctgctttagttgctttagccataaatgccaat
aagctgattttattaactgatatagaaaatttatattcaaaagacccaagaaataatgaa
gatgctcatccaataaaagaagttaatagtaatcaattgaaaattataaaagataaaaac
atccaaaattataataacgaatgggggacaggtggtattacaacaaaattaattgctgct
gaaatagcaacaaaaggaggtgtagaagttcaattagccgatggcagaaatgagaataat
ttaataaatattttcaatgaaaaaaaaatagggacaatatttcatcctgttgataaacca
gtaggtaataaaaaaagttggttatctcatgctattaaaacagttggacaaataacatta
gatgaaggtgcttgtcttgcaattgagcaaaaaggtgcctctcttctagttgtaggagtt
aaagaggtagaaggagattttactgttaatcaggctgttagaattgtaaatactaataag
aaagaagttgcaaaaggtataacatcaatgagtagtgattctctaaaaagaatcttaaat
aaaaaagaaaacattaattcatcaatgatcgttgttcatagggatgttcttgctcttacc
taa

DBGET integrated database retrieval system