KEGG   Prochlorococcus marinus subsp. pastoris CCMP1986: PMM0788Help
Entry
PMM0788           CDS       T00142                                 

Gene name
proB
Definition
(GenBank) putative glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
pmm  Prochlorococcus marinus subsp. pastoris CCMP1986
Pathway
pmm00330  Arginine and proline metabolism
pmm00332  Carbapenem biosynthesis
pmm01100  Metabolic pathways
pmm01130  Biosynthesis of antibiotics
pmm01230  Biosynthesis of amino acids
Module
pmm_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pmm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PMM0788 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    PMM0788 (proB)
Enzymes [BR:pmm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PMM0788 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: CAE19247
CYORF: PMM0788
UniProt: Q7V1R7
Position
complement(749890..750972)
Genome map
AA seq 360 aa AA seqDB search
MKKWVVKIGTSILRGNEDQSTEQVIESLCKSLTSFIFKGNKVILVTSGAVGLGCKKLNLN
TRPKELSALQAVAAVGQVNLMTLYEKTMKKLGHNIAQILITKTDFDSRESFNNASKTFQK
LIDLNVIPIVNENDSIANEELKYGDNDTLSALVALAINANKLILLTDIENLYSKDPRNNE
DAHPIKEVNSNQLKIIKDKNIQNYNNEWGTGGITTKLIAAEIATKGGVEVQLADGRNENN
LINIFNEKKIGTIFHPVDKPVGNKKSWLSHAIKTVGQITLDEGACLAIEQKGASLLVVGV
KEVEGDFTVNQAVRIVNTNKKEVAKGITSMSSDSLKRILNKKENINSSMIVVHRDVLALT
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatgggtcgtaaaaattggtactagtattctcagaggaaatgaggatcaatct
acagaacaagtaatagaaagtttatgtaaatctctaacaagttttatttttaaaggcaat
aaagtcattctcgtaacaagtggtgcggttggattaggatgtaaaaaattaaatttgaat
acaagaccaaaggaactcagtgcacttcaagctgtagctgcagtgggacaagttaattta
atgactttatatgaaaagacaatgaaaaagctaggtcataatatagctcaaatactaata
acaaaaactgattttgattcacgagaatccttcaataatgcttcaaaaacatttcaaaag
ttaattgatctgaatgtcatacctatagtcaacgagaatgattctattgccaatgaagag
cttaaatatggagacaatgatactctttctgctttagttgctttagccataaatgccaat
aagctgattttattaactgatatagaaaatttatattcaaaagacccaagaaataatgaa
gatgctcatccaataaaagaagttaatagtaatcaattgaaaattataaaagataaaaac
atccaaaattataataacgaatgggggacaggtggtattacaacaaaattaattgctgct
gaaatagcaacaaaaggaggtgtagaagttcaattagccgatggcagaaatgagaataat
ttaataaatattttcaatgaaaaaaaaatagggacaatatttcatcctgttgataaacca
gtaggtaataaaaaaagttggttatctcatgctattaaaacagttggacaaataacatta
gatgaaggtgcttgtcttgcaattgagcaaaaaggtgcctctcttctagttgtaggagtt
aaagaggtagaaggagattttactgttaatcaggctgttagaattgtaaatactaataag
aaagaagttgcaaaaggtataacatcaatgagtagtgattctctaaaaagaatcttaaat
aaaaaagaaaacattaattcatcaatgatcgttgttcatagggatgttcttgctcttacc
taa

DBGET integrated database retrieval system