KEGG   Prochlorococcus marinus MED4: PMM0829Help
Entry
PMM0829           CDS       T00142                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pmm  Prochlorococcus marinus MED4
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pmm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PMM0829 (tpiA)
   01230 Biosynthesis of amino acids
    PMM0829 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMM0829 (tpiA)
   00051 Fructose and mannose metabolism
    PMM0829 (tpiA)
   00562 Inositol phosphate metabolism
    PMM0829 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PMM0829 (tpiA)
Enzymes [BR:pmm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PMM0829 (tpiA)
Exosome [BR:pmm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PMM0829 (tpiA)
  Exosomal proteins of bladder cancer cells
   PMM0829 (tpiA)
  Exosomal proteins of melanoma cells
   PMM0829 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
784615..785340
Genome map
AA seq 241 aa AA seqDB search
MRKSVIAGNWKMHMTCADTKKYLEEFLPLIEEIPNDRKIVIAPPFTAISTFSNYTNFDYL
NIASQNIHWEDKGAFTAEISPNMLIEHKVKYAIVGHSEPRKYFSESDEQINKRAVFAQSS
GLTPIVCVGETLEQRERGEADRVITRQVEQGLENTDPSNLIVAYEPIWAIGTGKTCEASD
ANKICALIRSLIGFSDVIIQYGGSVKPNNIDEIMSMSDIDGVLVGGSSLDPISFSRIANF
E
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
ttgagaaaatctgtaatcgctgggaattggaagatgcacatgacttgtgctgacacaaaa
aaatatttggaagaatttcttcctcttattgaagaaattcctaatgacagaaaaatagta
attgctcctccctttacagctatttctactttttctaattatacaaactttgattattta
aatattgcaagtcaaaatatccattgggaagataaaggtgcttttactgcagaaatctcc
cccaatatgcttattgaacacaaagtaaaatatgcaattgttggtcatagtgaacctcgg
aaatactttagtgaaagtgatgaacaaattaataaaagagctgtctttgctcaatcaagt
ggactaactccaatagtttgtgtcggtgaaactcttgaacaaagagaaagaggtgaagcc
gatagggtcatcaccagacaagttgaacagggattagagaatactgatccatctaatctt
atagttgcttatgaacctatatgggcaattggtacaggtaaaacttgtgaagcaagtgac
gcaaacaagatatgtgctttgataaggagtttgattggttttagtgacgtaatcatccaa
tatggaggttctgttaaaccaaataatattgatgagatcatgtcaatgagtgatattgat
ggtgtcttggtaggtggttcttctttagatcctataagtttttcaagaattgcaaatttc
gaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system