KEGG   Prochlorococcus marinus MED4: PMM0830Help
Entry
PMM0830           CDS       T00142                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pmm  Prochlorococcus marinus MED4
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pmm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
785324..786166
Genome map
AA seq 280 aa AA seqDB search
MQISNNNYPWPDDWGRKTSIMGIINLTPDSFSDGGDFCSIEKVLNQVNYFVSNGVDVIDL
GAQSTRPGAIEIGAKNESKRLIPYLKKIRSEYPNILISIDTFNSEVAHEALSNGANWIND
VTGGRRDEEILDVVSEFNCPFVITHSRGNSITMNNLTNYDDFLVDIIHSLESLTKKALNK
NVSKDKIIWDPGIGFSKDTKQNIEILRNVPLLKNFEFPLLIGASRKRFIGEILNQPNPKE
RDIGTLAISCLCSQQKIHLVRVHNVKINYQVLKVADHIFR
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaatttcgaataataactacccttggcctgatgattgggggaggaaaacctccata
atggggattattaatttaactccagattcatttagtgatggaggtgatttttgttccata
gaaaaagttttaaatcaagtaaattattttgtttcaaatggagttgatgtaattgatctt
ggtgcacaaagtactagacccggagcgatagaaattggagcgaaaaatgaatcaaaaaga
ttaataccatatttaaaaaaaattagaagtgaatatcccaatattcttatttctattgat
acttttaattctgaggttgctcatgaagctctctcaaatggtgctaattggattaatgat
gtcacaggtggaagaagggatgaggagattttagatgttgtctcagaatttaattgtcct
ttcgtaattactcatagtcgcggaaatagcataaccatgaataatttgacaaattatgat
gattttttagttgatattattcattctcttgaaagtttgacaaaaaaagctctaaacaaa
aatgttagtaaggataaaataatttgggatccaggtattggattttcaaaggacactaaa
cagaacatagaaatcctaagaaacgtacctcttttaaagaattttgaatttccactccta
attggggcctcaagaaaaagatttattggagaaatcttaaatcaacctaatcccaaagaa
agagatataggaacactagctattagttgtctttgttctcaacaaaaaattcacttagta
agagttcataatgtaaaaatcaattatcaagttttaaaagtcgcagatcacatatttaga
taa

DBGET integrated database retrieval system