KEGG   Prochlorococcus marinus MED4: PMM0831Help
Entry
PMM0831           CDS       T00142                                 

Gene name
chlH
Definition
magnesium chelatase subunit H (EC:6.6.1.1)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
pmm  Prochlorococcus marinus MED4
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PMM0831 (chlH)
Enzymes [BR:pmm01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PMM0831 (chlH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(786182..790189)
Genome map
AA seq 1335 aa AA seqDB search
MFTQVRSANRRVSPVEDNKHKIVIKAVYVVLEPQYQNSLTEAAKSINETNGPIGIDLSGY
LIEELRNDKNFEDFKIDIASADIFVASLIFIEDLAQKVVDAVTPYKENLKASIIFPSMPE
VMRLNKLGSFSMAQLGQSKSIIGDLIKKKKESDGASFQDSMLKLLNTLPSILKYLPVEKA
QDARTFILSFQYWLGGTTENLKNFLLMISEKYVVSENIKDQLEEFKIQDPETFPDLGIWH
PLAPNMFESLNEYQNWEKNRKDIKPKDDKTPTIGLVLQRSHIVTGDDAHYVAVIQELEYR
GARVLPIFCGGLDFSKPVDEFYYHSNDKERAIVDGVVSLTGFALVGGPARQDHPKAIDAL
KKLNRPYMVALPLVFQTTQEWEESDLGLHPVQVALQIAIPELDGAIEPIILSGRDDATGK
AHTLQDRVDVIVERAIKWSTLRVKKRDEKKLAITVFSFPPDKGNVGTAAYLNVFGSIYRV
LLEMKAKGYQIDDLPKNSKELMEKVINNPEAMDGSPELNIAHKMTVKEYEEFTPYSKRLE
ENWGKPPGNLNSDGQNLLVYGKHFGNVFIGVQPTFGYEGDPMRLLYSRSASPHHGFAAYY
TYVEKIWGADAVLHFGTHGSLEFMPGKQMGMSETCYPDSLIGSLPNLYYYAANNPSEATI
AKRRGYASTISYLTPPAENAGLYKGLKELSELVGSYQQLRESSRGIQIVNAIVETSKQCN
LDKDVELPIGEVEELTIEDRDLFVGNIYKQLMEIESRLLPCGLHTIGEAPTAEEAVATLV
NIASLEREQEGLRSLPGLLAESINLKIDEVYDGNNKGELKFVELNEKIIKTARECIFAMV
NSLKIVNGRVYLEKSLFSKLLDFLKIFGLNLPTPWLRVCRLNGFNEINQKELNKLFDYLL
FCLEQVCADKEMDSLIKALDGNYVLPGPGGDPIRNPSVLPSGKNIHALDPQSIPTTAAVA
AAKSVVDKLIERQKEEQGTWPETIACVLWGTDNIKTYGESLAQILWFVGVKPKPDSVGRI
NKLELIPLEELGRPRIDVVVNCSGVFRDLFINQMALIDQAVKLAAEAEEPLESNFVRKHS
LEQADKEGTSIREASARVFSNASGSYSSNVNLAVENSTWEEENELQEMYLSRKTYAFNAD
NPGEMNQKRDVFESVMKTADVTFQNLDSSEISLTDVSHYFDSDPTKLIKTLRDDGKEPSS
YIADTTTSNAQVRTLGETIRLDSRTKLLNPKWYEGMLKSGYEGVRELSNRLNYTLGWSAT
SGQVDNFVYEETNETFINDEEMRKRLMDLNPNSFRRIVGTLLEVNGRGYWETSDENIEQL
KELYQEVEDKIEGVK
NT seq 4008 nt NT seq  +upstreamnt  +downstreamnt
atgtttacgcaggtccgctcagcaaatcgcagagtttctcctgttgaggataacaaacat
aaaattgtaataaaagcagtttatgttgtccttgagccacaatatcaaaactccttaaca
gaagctgcaaaatcaataaatgaaaccaatggccctatagggatagatctcagcggatat
cttatagaagaacttagaaacgataaaaatttcgaagattttaaaattgatatagctagt
gccgatatttttgttgcctccctaatatttatagaagatttagcacaaaaagttgtagat
gcagttaccccatataaagagaatcttaaagcctctataatttttccctcaatgcctgag
gtgatgagattaaataaattgggttcatttagcatggctcaacttggacaatctaaaagt
attatcggagatcttattaaaaagaaaaaagaatctgatggtgctagtttccaagattca
atgttgaagctactaaataccttaccttcaatactcaaatatttacctgtagaaaaagca
caagatgcaagaacatttatattaagttttcaatattggcttggcggaactacagaaaat
ctgaagaacttcttattaatgatctcagaaaaatatgtagtgtcagaaaatataaaagat
cagttagaagaatttaaaatacaagatcctgaaacttttccagatttaggtatatggcat
ccgttagcgccaaatatgtttgaaagtttaaatgaatatcaaaattgggaaaaaaataga
aaagatataaaaccaaaagatgataaaactccaactattggattagttctacaaagaagt
cacatagttacaggtgatgatgctcattatgtagccgtaatacaagaattagaatatcga
ggagctcgtgttttacctattttctgtggcggattagatttttctaaaccagtagatgaa
ttttattatcattcaaatgataaggaaagagcaatagttgatggggttgtatctttaaca
ggatttgcattggtaggtggtcctgcaagacaagatcatccaaaagccattgatgcactg
aaaaagctaaatagaccatatatggttgcattaccattagtatttcaaacaactcaagaa
tgggaggaaagtgatttaggattacaccctgttcaagttgcactccaaattgcgatacca
gaattagacggagctattgaaccaattattctttcaggtcgtgatgatgctactggtaaa
gcccatactctccaagacagagtagatgtcattgttgaaagagcaataaagtggtccact
cttagggtaaaaaaaagggatgagaaaaagttagcgataactgtatttagttttccacct
gacaaaggaaatgttggaacagcagcatatttgaatgtatttggttctatttatagagtt
cttttagaaatgaaagctaaagggtatcaaattgatgatctccctaaaaactccaaagaa
ttaatggagaaagtaattaataatccagaggctatggatggttctcctgaattaaatatt
gctcataagatgactgtaaaagaatatgaggaatttacaccttattcaaagagattagaa
gaaaactggggtaaacctcctggaaacttgaacagcgatggacaaaatttacttgtttac
ggaaaacattttggaaatgtatttataggagtgcaaccaacatttggatatgaaggagat
ccaatgagattactttactcaagaagtgctagtcctcaccatggatttgccgcttattac
acatacgtagaaaaaatatggggagctgatgcagttctacattttggaacacacggttca
cttgaatttatgcctgggaaacaaatgggtatgagtgaaacttgctacccagattcttta
ataggatctctgccaaatttatattattacgcagcaaataatccatcagaagcaacaatt
gcaaaaagaagaggttacgcatcaacaataagttacctaactcctccagctgaaaatgct
ggtctttataagggacttaaagaattgagcgagcttgtaggttcttatcaacaactcaga
gaaagtagtagaggtattcaaattgttaatgcaatagtagagacttcaaagcaatgtaat
ctcgataaagatgtagaactccctattggtgaggttgaggaactaactattgaagataga
gatctgtttgtagggaatatatataagcaattaatggagatagaaagtagattattgcca
tgtggactccatacaattggagaggctcctactgcggaggaagccgttgccaccttagta
aacatagcttcgttagaaagagaacaagaaggtcttagatccttaccaggtttattagca
gaatcaataaatttaaaaattgatgaagtttacgacggtaataataagggagaacttaag
tttgttgaactaaatgaaaaaattataaaaactgccagagaatgcatatttgcaatggtt
aatagtctaaaaattgttaacggaagggtctatttggagaaatcactattttcaaaacta
ttagatttcttgaagatatttggtttaaatttacctaccccttggctgagagtatgtaga
ttaaatggatttaatgaaataaatcaaaaagaattaaataaattatttgactatttattg
ttctgccttgaacaggtatgtgcagacaaagaaatggatagcctcataaaagccttggat
ggaaattatgtattacctggccctggaggagatcctattaggaacccaagcgttttacca
agtggtaaaaatattcatgcacttgatccacaatcaattcctactactgcagcagtagct
gcagctaaatctgtagtagacaaattaattgaaagacaaaaagaagagcaaggaacttgg
cctgaaacaatagcttgtgttttatggggtactgacaatatcaaaacttatggtgaatct
ctagctcaaattttatggtttgtaggagtcaaaccaaaacctgattctgttggtcgaata
aataaattagaacttatcccgttagaggaacttggtagaccaagaattgatgtggttgta
aattgctctggagtttttagggatttatttataaaccaaatggcacttattgatcaggcc
gtaaaattagccgcagaagcagaagaaccattagagtccaactttgtaagaaaacattca
ttagaacaagctgataaagagggtacctcaataagggaggcttcagcaagagtattttca
aatgctagcggcagctatagttcaaatgtcaatttagctgtagaaaattcaacctgggag
gaagaaaatgaattgcaagaaatgtatttatcaagaaaaacttatgcttttaatgctgat
aacccaggagaaatgaatcaaaaaagggatgtattcgagtctgtcatgaaaactgctgat
gtaacatttcaaaaccttgactcttctgaaatctctctaactgatgtcagccattatttt
gattctgatcctactaaattaataaaaacgttaagggatgatgggaaagaaccaagtagt
tacattgcagacacaactacatctaatgctcaagtcaggacattaggtgaaacaataaga
ctagattctagaactaagcttttgaatccaaaatggtacgaaggaatgcttaagtcagga
tatgaaggagttagagaactttctaatagacttaactacacacttggatggagtgcaaca
agtggccaagtagataactttgtttatgaagaaactaatgaaacattcattaatgatgaa
gaaatgagaaaaaggcttatggatttaaatcctaatagtttcagaagaatagtaggaaca
ttgctcgaagtaaatgggagaggttattgggaaacatccgatgaaaatatagagcaactt
aaagaactttatcaagaagtagaggataaaattgagggagttaaatag

DBGET integrated database retrieval system