KEGG   Prochlorococcus marinus MED4: PMM0942Help
Entry
PMM0942           CDS       T00142                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pmm  Prochlorococcus marinus MED4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PMM0942 (ruvA)
Enzymes [BR:pmm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PMM0942 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
900350..901009
Genome map
AA seq 219 aa AA seqDB search
MISWIKGELVSSWQANNKFYILVNCQGLGYEIQTLESVFFDINSNKISEKEIILWLKHIK
KEDSDMLFGFSTKDQRDFFIQILNIKGIGSQIGMSLLNKFSLNQLITAISNNDKKSISTV
QGIGQKMTERIILELKSKVINKEIEKENLNINNFLEKNKDLDSIFKDIDLTLQSLNYSKK
EIKNLFPKLINNIKNSSLEKESISFENLLKEAMNYLDHK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
ttgattagttggataaagggagaattagtaagttcatggcaagctaataataaattttat
attttagtaaactgtcagggattaggttatgaaattcagaccctagaatcagtatttttt
gatatcaattcaaataagatttctgaaaaggaaataatcctctggctaaaacatataaaa
aaagaagattctgatatgctctttggttttagcaccaaggaccaaagagatttctttatt
caaattttaaatattaaaggtataggctcccaaatcgggatgtctttattaaataaattt
tccttaaatcaattaattacggcaatatctaataatgacaaaaaatcgattagtactgtt
caaggtattgggcaaaaaatgactgaacgaataatccttgagctgaaaagtaaggtaatt
aataaagaaattgaaaaagagaatttaaatataaataatttcctagaaaaaaataaagac
ttagattcaatttttaaagatattgatttaacacttcaatctttaaactattctaagaaa
gaaattaaaaacctatttccaaaacttattaataatattaaaaattcatccttagaaaaa
gaatctatttcttttgaaaatttattaaaagaagccatgaattatttagaccataaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system