KEGG   Prochlorococcus marinus MED4: PMM0956Help
Entry
PMM0956           CDS       T00142                                 

Definition
(GenBank) Bacitracin resistance protein BacA
  KO
K06153  
undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
pmm  Prochlorococcus marinus MED4
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pmm00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PMM0956
Enzymes [BR:pmm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     PMM0956
Peptidoglycan biosynthesis and degradation proteins [BR:pmm01011]
 Precursor biosynthesis
  Diphosphatase
   PMM0956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
CYORF: 
UniProt: 
Position
complement(914736..915536)
Genome map
AA seq 266 aa AA seqDB search
MEFFKYIFYGIIQGLTEFIPISSTAHLKIISLLFGMDDPGSSVSAIIQIGSVFAIFWYFR
KSISNYKNTNSRKPSYSFLFNKLNKSIFIGTIPIVFIGVIIKLFVPGFSDSFLRSNLSIA
LVSILMSLIMLFADISTKKSINLNNHKYPNNLYIGIAQAFAIVPGVSRSGATISMALLSG
WNRKDAAKFSFLLGIPSISLAAFVEFFSAVNQFSTFPFLPLFAGLITAFFSSLLAINFLI
KYVSSHGLKIFVYYRLIFGILILFNL
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
ttggaattttttaagtatattttttatggaataattcaaggtttaacagagtttattcct
ataagtagtactgctcatttaaaaatcatatctctattatttggaatggatgatcctggt
tcctcagtttctgcaattatacaaattggaagtgtttttgcaatattttggtattttagg
aaaagtatttctaattacaaaaatacaaactctagaaaaccaagttattcatttttgttt
aataaattaaataaatctatctttataggtacaattccaattgtttttattggtgtaatt
ataaagctatttgttccaggattctctgattcatttttacgttcaaatctttcaatagct
ttagtgtctatattaatgtctttaataatgctttttgcagatatttctactaagaaatca
attaatttaaacaatcataaatatccaaacaacttatatataggaattgctcaagccttt
gcaattgttcctggagtatctcgttcaggagccactatttctatggctcttttatctgga
tggaatagaaaagatgcagctaaattttcattccttcttggtattccttcaatctcgtta
gcagcttttgttgagttttttagtgcagtaaatcaattttcaacatttccattccttcct
ctttttgctggattaattacagctttcttctcttctctattagccatcaattttttaata
aagtatgtttcctctcatggactcaaaatatttgtttattatcgtttaatattcggaatc
ttgattcttttcaatttatag

DBGET integrated database retrieval system